Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET0QE2L)
Name
Monoamine transporter VAT2 (VMAT2)
Synonyms    Click to Show/Hide the Synonyms of This DBT
Synaptic vesicle amine transporter; SLC18A2; Solute carrier family 18 member 2; VAT; VAT2; VMAT; Vesicular Monoamine Transporter; Vesicular amine transporter; Vesicular amine transporter 2; SLC18A2
Family Potential-driven transporter (PDT)  >>  Major facilitator (MF)
Organism
Homo sapiens (Human)
Gene Name SLC18A2 Gene ID
6571
UniProt ID VMAT2_HUMAN (click to find more protein-related data of this DBT)
TTD ID T48873 (click to find more therapeutic target data of this DBT)
VARIDT ID DTD0034 (click to find more drug transporter data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MALSELALVRWLQESRRSRKLILFIVFLALLLDNMLLTVVVPIIPSYLYSIKHEKNATEI
QTARPVHTASISDSFQSIFSYYDNSTMVTGNATRDLTLHQTATQHMVTNASAVPSDCPSE
DKDLLNENVQVGLLFASKATVQLITNPFIGLLTNRIGYPIPIFAGFCIMFVSTIMFAFSS
SYAFLLIARSLQGIGSSCSSVAGMGMLASVYTDDEERGNVMGIALGGLAMGVLVGPPFGS
VLYEFVGKTAPFLVLAALVLLDGAIQLFVLQPSRVQPESQKGTPLTTLLKDPYILIAAGS
ICFANMGIAMLEPALPIWMMETMCSRKWQLGVAFLPASISYLIGTNIFGILAHKMGRWLC
ALLGMIIVGVSILCIPFAKNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGS
VYAIADVAFCMGYAIGPSAGGAIAKAIGFPWLMTIIGIIDILFAPLCFFLRSPPAKEEKM
AILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD
Function
Involved in the ATP-dependent vesicular transport of biogenic amine neurotransmitters. Pumps cytosolic monoamines including dopamine, norepinephrine, serotonin, and histamine into synaptic vesicles. Requisite for vesicular amine storage prior to secretion via exocytosis.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Benzoic acid Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 18 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID VMAT2_HUMAN
          DIG Name: Butylparaben Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 6.6 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID VMAT2_HUMAN
          DIG Name: Cetylpyridinium chloride Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative; Penetration agent; Solubilizing agent; Surfactant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 0.73 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID VMAT2_HUMAN
          DIG Name: Oleic acid Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Penetration agent; Solubilizing agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 4.7 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID VMAT2_HUMAN
          DIG Name: Palmitic acid Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Penetration agent; lubricant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 4.4 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID VMAT2_HUMAN
          DIG Name: Benzethonium chloride Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative; Surfactant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 0.18 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID VMAT2_HUMAN
          DIG Name: Chloroxylenol Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 0.79 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID VMAT2_HUMAN
          DIG Name: Ethylparaben Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 22 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID VMAT2_HUMAN
          DIG Name: Phenylmercuric acetate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 0.36 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID VMAT2_HUMAN
          DIG Name: Thimerosal Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 0.97 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID VMAT2_HUMAN
          DIG Name: Thymol Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antioxidant; Flavoring agent; Penetration agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 25 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID VMAT2_HUMAN
References
1 The activities of drug inactive ingredients on biological targets. Science. 2020 Jul 24;369(6502):403-413.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.