Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET0TN3C)
Name
Deacetylase sirtuin-6 (SIRT6)
Synonyms    Click to Show/Hide the Synonyms of This DBT
NAD-dependent deacetylase sirtuin-6; NAD-dependent protein deacetylase sirtuin-6; Regulatory protein SIR2 homolog 6; SIR2-like protein 6
Family Transferase (TFase)  >>  Acyltransferase (EC 2.3)
Organism
Homo sapiens (Human)
Gene Name SIRT6 Gene ID
51548
UniProt ID SIR6_HUMAN (click to find more protein-related data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASG
IPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHV
RSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGE
LRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVN
LQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLEPK
EESPTRINGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKAKAVPS
Function
NAD-dependent protein deacetylase. Has deacetylase activity towards histone H3K9Ac and H3K56Ac. Modulates acetylation of histone H3 in telomeric chromatin during the S-phase of the cell cycle. Deacetylates histone H3K9Ac at NF-kappa-B target promoters and may down-regulate the expression of a subset of NF-kappa-B target genes. Acts as a corepressor of the transcription factor HIF1A to control the expression of multiple glycolytic genes to regulate glucose homeostasis.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Niacinamide Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antioxidant; Solubilizing agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 120000 nM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SIR6_HUMAN
References
1 Development of Peptide-Based Sirtuin Defatty-Acylase Inhibitors Identified by the Fluorescence Probe, SFP3, That Can Efficiently Measure Defatty-Acylase Activity of Sirtuin. J Med Chem. 2019 Jun 13; 62(11):5434-5452.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.