Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET0UC8K)
Name
Deacetylase sirtuin-2 (SIRT2)
Synonyms    Click to Show/Hide the Synonyms of This DBT
NAD-dependent deacetylase sirtuin-2; NAD-dependent protein deacetylase sirtuin-2; NADdependent protein deacetylase sirtuin2; Regulatory protein SIR2 homolog 2; SIR2-like protein 2; SIR2L; SIR2L2; SIR2like protein 2
Family Transferase (TFase)  >>  Acyltransferase (EC 2.3)
Organism
Homo sapiens (Human)
Gene Name SIRT2 Gene ID
22933
UniProt ID SIR2_HUMAN (click to find more protein-related data of this DBT)
TTD ID T83904 (click to find more therapeutic target data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MAEPDPSHPLETQAGKVQEAQDSDSDSEGGAAGGEADMDFLRNLFSQTLSLGSQKERLLD
ELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHLPYPEAIFE
ISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTLERIAGLEQ
EDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLP
ARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQSDPFLGMI
MGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASIDAQSGAGV
PNPSTSASPKKSPPPAKDEARTTEREKPQ
Function
Participates in the modulation of multiple and diverse biological processes such as cell cycle control, genomic integrity, microtubule dynamics, cell differentiation, metabolic networks, and autophagy. Plays a major role in the control of cell cycle progression and genomic stability. Functions in the antephase checkpoint preventing precocious mitotic entry in response to microtubule stress agents, and hence allowing proper inheritance of chromosomes.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Niacinamide Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antioxidant; Solubilizing agent
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 1200 nM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SIR2_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 < 50000 nM (tested by experiment) [2]
                   Tested Species Saccharomyces cerevisiae (Yeast)
                   UniProt ID SIR2_YEAST
References
1 Aminothiazoles as Potent and Selective Sirt2 Inhibitors: A Structure-Activity Relationship Study. J Med Chem. 2016 Feb 25; 59(4):1599-612.
2 How much successful are the medicinal chemists in modulation of SIRT1: A critical review. Eur J Med Chem. 2016 Aug 25; 119:45-69.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.