Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET0V8BU) | |||||
|---|---|---|---|---|---|
| Name |
Solute carrier SLC5A7 (CHT1)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Solute carrier family 5 member 7; CHT; Hemicholinium-3-sensitive choline transporter; High affinity choline transporter 1; SLC5A7; CHT1
|
||||
| Family | Potential-driven transporter (PDT) >> Sodium:solute symporter (SSF) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | SLC5A7 | Gene ID | |||
| UniProt ID | SC5A7_HUMAN | (click to find more protein-related data of this DBT) | |||
| TTD ID | T83143 | (click to find more therapeutic target data of this DBT) | |||
| VARIDT ID | DTD0427 | (click to find more drug transporter data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MAFHVEGLIAIIVFYLLILLVGIWAAWRTKNSGSAEERSEAIIVGGRDIGLLVGGFTMTA
TWVGGGYINGTAEAVYVPGYGLAWAQAPIGYSLSLILGGLFFAKPMRSKGYVTMLDPFQQ IYGKRMGGLLFIPALMGEMFWAAAIFSALGATISVIIDVDMHISVIISALIATLYTLVGG LYSVAYTDVVQLFCIFVGLWISVPFALSHPAVADIGFTAVHAKYQKPWLGTVDSSEVYSW LDSFLLLMLGGIPWQAYFQRVLSSSSATYAQVLSFLAAFGCLVMAIPAILIGAIGASTDW NQTAYGLPDPKTTEEADMILPIVLQYLCPVYISFFGLGAVSAAVMSSADSSILSASSMFA RNIYQLSFRQNASDKEIVWVMRITVFVFGASATAMALLTKTVYGLWYLSSDLVYIVIFPQ LLCVLFVKGTNTYGAVAGYVSGLFLRITGGEPYLYLQPLIFYPGYYPDDNGIYNQKFPFK TLAMVTSFLTNICISYLAKYLFESGTLPPKLDVFDAVVARHSEENMDKTILVKNENIKLD ELALVKPRQSMTLSSTFTNKEAFLDVDSSPEGSGTEDNLQ |
||||
| Function |
Transmembrane transporter that imports choline from the extracellular space to the neuron with high affinity. Choline uptake is the rate-limiting step in acetylcholine synthesis. Sodium ion- and chloride ion-dependent.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: Cetylpyridinium chloride | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
 click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative; Penetration agent; Solubilizing agent; Surfactant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Ki = 32062.69 nM (tested by experiment) | [1] | ||||
| Tested Species | Mus musculus (Mouse) | |||||
| UniProt ID | SC5A7_MOUSE | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | 3-D-QSAR and docking studies on the neuronal choline transporter. Bioorg Med Chem Lett. 2010 Aug 15; 20(16):4870-7. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.