Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET0W8WT) | |||||
|---|---|---|---|---|---|
| Name |
Muscarinic receptor M5 (ACM5)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Muscarinic acetylcholine receptor M5; Cholinergic receptor, muscarinic 5; M5R; M5 receptor; CHRM5; Chrm5; Cholinergic/acetylcholine receptor M5
|
||||
| Family | G-protein coupled receptor (GPCR) >> G-protein coupled rhodopsin receptor (GPCR-A) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | CHRM5 | Gene ID | |||
| UniProt ID | ACM5_HUMAN | (click to find more protein-related data of this DBT) | |||
| TTD ID | T79961 | (click to find more therapeutic target data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MEGDSYHNATTVNGTPVNHQPLERHRLWEVITIAAVTAVVSLITIVGNVLVMISFKVNSQ
LKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMN LLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGKRTVPL DECQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSVTKAE KRKPAHRALFRSCLRCPRPTLAQRERNQASWSSSRRSTSTTGKPSQATGPSANWAKAEQL TTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPN YLLSPAAAHRPKSQKCVAYKFRLVVKADGNQETNNGCHKVKIMPCPFPVAKEPSTKGLNP NPSHQMTKRKRVVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVTLWHLG YWLCYVNSTVNPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP |
||||
| Function |
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: Methylpyrrolidone | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
 click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Penetration agent; Solubilizing agent; Solvent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | EC50 = 2300 nM (estimated based on the structural similarity with CHEMBL23957 ) | [1] | ||||
| Structural Similarity | Tanimoto coefficient = 0.87804878 | |||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | ACM5_HUMAN | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | FRET-based sensors for the human M1-, M3-, and M5-acetylcholine receptors. Bioorg Med Chem. 2011 Feb 1; 19(3):1048-54. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.