Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET0X0TC) | |||||
---|---|---|---|---|---|
Name |
S1P receptor 4 (S1PR4)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
Sphingosine 1-phosphate receptor 4; S1P receptor Edg-6; S1P4; Endothelial differentiation G-protein coupled receptor 6; Sphingosine 1-phosphate receptor Edg-6
|
||||
Family | G-protein coupled receptor (GPCR) >> G-protein coupled rhodopsin receptor (GPCR-A) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | S1PR4 | Gene ID | |||
UniProt ID | S1PR4_HUMAN | (click to find more protein-related data of this DBT) | |||
TTD ID | T17523 | (click to find more therapeutic target data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MNATGTPVAPESCQQLAAGGHSRLIVLHYNHSGRLAGRGGPEDGGLGALRGLSVAASCLV
VLENLLVLAAITSHMRSRRWVYYCLVNITLSDLLTGAAYLANVLLSGARTFRLAPAQWFL REGLLFTALAASTFSLLFTAGERFATMVRPVAESGATKTSRVYGFIGLCWLLAALLGMLP LLGWNCLCAFDRCSSLLPLYSKRYILFCLVIFAGVLATIMGLYGAIFRLVQASGQKAPRP AARRKARRLLKTVLMILLAFLVCWGPLFGLLLADVFGSNLWAQEYLRGMDWILALAVLNS AVNPIIYSFRSREVCRAVLSFLCCGCLRLGMRGPGDCLARAVEAHSGASTTDSSLRPRDS FRGSRSLSFRMREPLSSISSVRSI |
||||
Function |
Receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. May be involved in cell migration processes that are specific for lymphocytes
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Delfen | Click to Show/Hide | |||||
Detailed Information | DIG Info click to show the detail info of this DIG | |||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Surfactant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | EC50 = 440000 nM (estimated based on the structural similarity with CHEMBL228137 ) | [1] | ||||
Structural Similarity | Tanimoto coefficient = 0.894736842 | |||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | S1PR4_HUMAN | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.