Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET0Y7SI)
Name
Kisspeptins receptor (KISS1R)
Synonyms    Click to Show/Hide the Synonyms of This DBT
KiSS-1 receptor GPR54; KiSS-1R; Metastin receptor; G-protein coupled receptor 54; G-protein coupled receptor OT7T175; GPR54; Hypogonadotropin-1; KISS1R; hOT7T175
Family G-protein coupled receptor (GPCR)  >>  G-protein coupled rhodopsin receptor (GPCR-A)
Organism
Homo sapiens (Human)
Gene Name KISS1R Gene ID
84634
UniProt ID KISSR_HUMAN (click to find more protein-related data of this DBT)
TTD ID T39123 (click to find more therapeutic target data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MHTVATSGPNASWGAPANASGCPGCGANASDGPVPSPRAVDAWLVPLFFAALMLLGLVGN
SLVIYVICRHKPMRTVTNFYIANLAATDVTFLLCCVPFTALLYPLPGWVLGDFMCKFVNY
IQQVSVQATCATLTAMSVDRWYVTVFPLRALHRRTPRLALAVSLSIWVGSAAVSAPVLAL
HRLSPGPRAYCSEAFPSRALERAFALYNLLALYLLPLLATCACYAAMLRHLGRVAVRPAP
ADSALQGQVLAERAGAVRAKVSRLVAAVVLLFAACWGPIQLFLVLQALGPAGSWHPRSYA
AYALKTWAHCMSYSNSALNPLLYAFLGSHFRQAFRRVCPCAPRRPRRPRRPGPSDPAAPH
AELLRLGSHPAPARAQKPGSSGLAARGLCVLGEDNAPL
Function
Receptor for metastin(kisspeptin-54 or kp-54), a C- terminally amidated peptide of KiSS1. KiSS1 is a metastasis suppressor protein that suppresses metastases in malignant melanomas and in some breast carcinomas without affecting tumorigenicity. The metastasis suppressor properties may be mediated in part by cell cycle arrest and induction of apoptosis in malignant cells. The receptor is essential for normal gonadotropin-released hormone physiology and for puberty.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Benzethonium chloride Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative; Surfactant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 3600 nM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID KISSR_HUMAN
References
1 Metastin (KiSS-1) mimetics identified from peptide structure-activity relationship-derived pharmacophores and directed small molecule database screening. J Med Chem. 2007 Feb 8; 50(3):462-71.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.