Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET0YO5Y) | |||||
---|---|---|---|---|---|
Name |
Tyrosine 3-monooxygenase (TH)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
Tyrosine 3-hydroxylase; TH
|
||||
Family | Oxidoreductase (ORase) >> Oxygen paired donor oxidoreductase (EC 1.14) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | TH | Gene ID | |||
UniProt ID | TY3H_HUMAN | (click to find more protein-related data of this DBT) | |||
TTD ID | T62390 | (click to find more therapeutic target data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MPTPDATTPQAKGFRRAVSELDAKQAEAIMVRGQGAPGPSLTGSPWPGTAAPAASYTPTP
RSPRFIGRRQSLIEDARKEREAAVAAAAAAVPSEPGDPLEAVAFEEKEGKAVLNLLFSPR ATKPSALSRAVKVFETFEAKIHHLETRPAQRPRAGGPHLEYFVRLEVRRGDLAALLSGVR QVSEDVRSPAGPKVPWFPRKVSELDKCHHLVTKFDPDLDLDHPGFSDQVYRQRRKLIAEI AFQYRHGDPIPRVEYTAEEIATWKEVYTTLKGLYATHACGEHLEAFALLERFSGYREDNI PQLEDVSRFLKERTGFQLRPVAGLLSARDFLASLAFRVFQCTQYIRHASSPMHSPEPDCC HELLGHVPMLADRTFAQFSQDIGLASLGASDEEIEKLSTLYWFTVEFGLCKQNGEVKAYG AGLLSSYGELLHCLSEEPEIRAFDPEAAAVQPYQDQTYQSVYFVSESFSDAKDKLRSYAS RIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAIG |
||||
Function |
Plays an important role in the physiology of adrenergic neurones.
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Propyl gallate | Click to Show/Hide | |||||
Detailed Information | DIG Info click to show the detail info of this DIG | |||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative; Antioxidant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Ki = 1.9 uM (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | TY3H_HUMAN | |||||
References | |||||
---|---|---|---|---|---|
1 | The activities of drug inactive ingredients on biological targets. Science. 2020 Jul 24;369(6502):403-413. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.