Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET0O0SV) | |||||
|---|---|---|---|---|---|
| Name |
Squalene monooxygenase (SQLE)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Oxidosqaulene cyclase; SE; SQLE; Squalene epoxidase
|
||||
| Family | Oxidoreductase (ORase) >> Oxygen paired donor oxidoreductase (EC 1.14) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | SQLE | Gene ID | |||
| UniProt ID | ERG1_HUMAN | (click to find more protein-related data of this DBT) | |||
| TTD ID | T93344 | (click to find more therapeutic target data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MWTFLGIATFTYFYKKFGDFITLANREVLLCVLVFLSLGLVLSYRCRHRNGGLLGRQQSG
SQFALFSDILSGLPFIGFFWAKSPPESENKEQLEARRRRKGTNISETSLIGTAACTSTSS QNDPEVIIVGAGVLGSALAAVLSRDGRKVTVIERDLKEPDRIVGEFLQPGGYHVLKDLGL GDTVEGLDAQVVNGYMIHDQESKSEVQIPYPLSENNQVQSGRAFHHGRFIMSLRKAAMAE PNAKFIEGVVLQLLEEDDVVMGVQYKDKETGDIKELHAPLTVVADGLFSKFRKSLVSNKV SVSSHFVGFLMKNAPQFKANHAELILANPSPVLIYQISSSETRVLVDIRGEMPRNLREYM VEKIYPQIPDHLKEPFLEATDNSHLRSMPASFLPPSSVKKRGVLLLGDAYNMRHPLTGGG MTVAFKDIKLWRKLLKGIPDLYDDAAIFEAKKSFYWARKTSHSFVVNILAQALYELFSAT DDSLHQLRKACFLYFKLGGECVAGPVGLLSVLSPNPLVLIGHFFAVAIYAVYFCFKSEPW ITKPRALLSSGAVLYKACSVIFPLIYSEMKYMVH |
||||
| Function |
Catalyzes the first oxygenation step in sterol biosynthesis and is suggested to be one of the rate-limiting enzymes in this pathway.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: Dodecyl gallate | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Antioxidant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 61 nM (tested by experiment) | [1] | ||||
| Tested Species | Rattus norvegicus (Rat) | |||||
| UniProt ID | ERG1_RAT | |||||
| DIG Name: Octyl gallate | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Antioxidant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 830 nM (tested by experiment) | [1] | ||||
| Tested Species | Rattus norvegicus (Rat) | |||||
| UniProt ID | ERG1_RAT | |||||
| DIG Name: Oleyl alcohol | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Emollient; Emulsifying agent; Penetration agent; Solubilizing agent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 4000 nM (estimated based on the structural similarity with CHEMBL416643 ) | [2] | ||||
| Structural Similarity | Tanimoto coefficient = 0.866666667 | |||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | ERG1_HUMAN | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

