Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET0PG6J) | |||||
|---|---|---|---|---|---|
| Name |
Carbonic anhydrase IX (CA9)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Carbonate dehydratase IX; Carbonic anhydrase IX; CA-IX; CAIX; Membrane antigen MN; P54/58N; Renal cell carcinoma-associated antigen G250; RCC-associated antigen G250; pMW1; PMW1; MN; G250 antigen (MN/CA IX/G250); G250; Carbonic anhydrase 9
|
||||
| Family | Lyase/isomerase/ligase (L/I/G) >> Carbon-oxygen lyase (EC 4.2) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | CA9 | Gene ID | |||
| UniProt ID | CAH9_HUMAN | (click to find more protein-related data of this DBT) | |||
| TTD ID | T64567 | (click to find more therapeutic target data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MAPLCPSPWLPLLIPAPAPGLTVQLLLSLLLLVPVHPQRLPRMQEDSPLGGGSSGEDDPL
GEEDLPSEEDSPREEDPPGEEDLPGEEDLPGEEDLPEVKPKSEEEGSLKLEDLPTVEAPG DPQEPQNNAHRDKEGDDQSHWRYGGDPPWPRVSPACAGRFQSPVDIRPQLAAFCPALRPL ELLGFQLPPLPELRLRNNGHSVQLTLPPGLEMALGPGREYRALQLHLHWGAAGRPGSEHT VEGHRFPAEIHVVHLSTAFARVDEALGRPGGLAVLAAFLEEGPEENSAYEQLLSRLEEIA EEGSETQVPGLDISALLPSDFSRYFQYEGSLTTPPCAQGVIWTVFNQTVMLSAKQLHTLS DTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVDSSPRAAEPVQLNSCLAAGDILALVF GLLFAVTSVAFLVQMRRQHRRGTKGGVSYRPAEVAETGA |
||||
| Function |
Participates in pH regulation. May be involved in the control of cell proliferation and transformation. Appears to be a novel specific biomarker for a cervical neoplasia. Reversible hydration of carbon dioxide.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: Acesulfame | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Flavoring agent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Ki = 2400 nM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CAH9_HUMAN | |||||
| DIG Name: Benzosulfimide | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Flavoring agent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Ki = 100 nM (tested by experiment) | [2] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CAH9_HUMAN | |||||
| DIG Name: Calcium carbonate | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Binding agent; Buffering agent; Diluent; Opacifying agent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Ki = 8600 nM (estimated based on the structural similarity with CHEMBL1161632 ) | [3] | ||||
| Structural Similarity | Tanimoto coefficient = 1 | |||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CAH9_HUMAN | |||||
| DIG Name: methylparaben | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Ki = 5500 nM (tested by experiment) | [4] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CAH9_HUMAN | |||||
| DIG Name: Sucralose | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Flavoring agent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Ki = 2200 nM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CAH9_HUMAN | |||||
| DIG Name: Compressible sugar | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Binding agent; Diluent; Flavoring agent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Ki > 20000 nM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CAH9_HUMAN | |||||
| DIG Name: Ethylparaben | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Ki = 8200 nM (tested by experiment) | [4] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CAH9_HUMAN | |||||
| DIG Name: Gentisic acid | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Antioxidant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Ki = 6600 nM (tested by experiment) | [4] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CAH9_HUMAN | |||||
| DIG Name: Hydroquinone | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Antioxidant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Ki = 32500 nM (tested by experiment) | [5] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CAH9_HUMAN | |||||
| DIG Name: Phenol | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Ki = 8800 nM (tested by experiment) | [6] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CAH9_HUMAN | |||||
| DIG Name: Sodium cyclamate | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Flavoring agent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Ki = 81.3 nM (tested by experiment) | [7] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CAH9_HUMAN | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

