Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET0XJ4G) | |||||
---|---|---|---|---|---|
Name |
Carbonic anhydrase I (CA1)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
Carbonate dehydratase I; Carbonic anhydrase B; CAB; Carbonic anhydrase I; CA-I; Carbonic anhydrase 1; CAB
|
||||
Family | Lyase/isomerase/ligase (L/I/G) >> Carbon-oxygen lyase (EC 4.2) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | CA1 | Gene ID | |||
UniProt ID | CAH1_HUMAN | (click to find more protein-related data of this DBT) | |||
TTD ID | T13201 | (click to find more therapeutic target data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEI
INVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELH VAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNF DPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAV PMQHNNRPTQPLKGRTVRASF |
||||
Function |
Can hydrates cyanamide to urea. Reversible hydration of carbon dioxide.
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Aminobenzoate sodium | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Lubricant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Ki = 8400 nM (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | CAH1_HUMAN | |||||
DIG Name: Benzosulfimide | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Flavoring agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Ki > 10000 nM (tested by experiment) | [2] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | CAH1_HUMAN | |||||
DIG Name: Butylated hydroxytoluene | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Antioxidant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Ki = 245200 nM (tested by experiment) | [3] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | CAH1_HUMAN | |||||
DIG Name: methylparaben | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Ki = 2600 nM (tested by experiment) | [4] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | CAH1_HUMAN | |||||
DIG Name: Saccharin sodium anhydrous | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Flavoring agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Ki = 18540 nM (estimated based on the structural similarity with CHEMBL310671 ) | [5] | ||||
Structural Similarity | Tanimoto coefficient = 0.970873786 | |||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | CAH1_HUMAN | |||||
DIG Name: Tannic acid | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Antioxidant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Ki = 75900 nM (tested by experiment) | [6] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | CAH1_HUMAN | |||||
DIG Name: Ammonium sulfate | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Buffering agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Ki = 35000 nM (estimated based on the structural similarity with CHEMBL355001 ) | [7] | ||||
Structural Similarity | Tanimoto coefficient = 0.769230769 | |||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | CAH1_HUMAN | |||||
DIG Name: Ethylparaben | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Ki = 7900 nM (tested by experiment) | [4] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | CAH1_HUMAN | |||||
DIG Name: Gentisic acid | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Antioxidant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Ki = 4200 nM (tested by experiment) | [4] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | CAH1_HUMAN | |||||
DIG Name: Hydroquinone | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Antioxidant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Ki = 10700 nM (tested by experiment) | [8] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | CAH1_HUMAN | |||||
DIG Name: Phenol | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Ki = 10100 nM (tested by experiment) | [9] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | CAH1_HUMAN | |||||
DIG Name: Sodium acetate | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative; Buffering agent; Flavoring agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Ki = 10800 nM (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | CAH1_HUMAN | |||||
DIG Name: Sodium cyclamate | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Flavoring agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Ki > 10000 nM (tested by experiment) | [10] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | CAH1_HUMAN | |||||
DIG Name: Sodium iodide | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Ki = 300000 nM (tested by experiment) | [11] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | CAH1_HUMAN | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.