Target Information
| Target General Infomation | |||||
|---|---|---|---|---|---|
| Target ID |
T60366
|
||||
| Former ID |
TTDS00313
|
||||
| Target Name |
Ornithine decarboxylase
|
||||
| Gene Name |
ODC1
|
||||
| Synonyms |
ODC; ODC1
|
||||
| Target Type |
Clinical Trial
|
||||
| Disease | African trypanosomiasis [ICD9: 86.5; ICD10: B56] | ||||
| Burns and burn infection [ICD9: 001-139; ICD10: A00-B99] | |||||
| Head and neck cancer [ICD9: 140-149, 140-229; ICD10: C07-C14, C32-C33] | |||||
| Trypanosoma brucei gambiense infection [ICD9: 86.5; ICD10: B56] | |||||
| Function |
Key enzyme of polyamine biosynthesis that converts ornithine into putrescine, which is the precursor for the polyamines, spermidine and spermine.
|
||||
| BioChemical Class |
Carbon-carbon lyase
|
||||
| Target Validation |
T60366
|
||||
| UniProt ID | |||||
| EC Number |
EC 4.1.1.17
|
||||
| Sequence |
MNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALP
RVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQI KYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLRTSRLL LERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPG SEDVKLKFEEITGVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKIVLKEQ TGSDDEDESSEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKYYSSSIWGPTC DGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPAWQLMQQF QNPDFPPEVEEQDASTLPVSCAWESGMKRHRAACASASINV |
||||
| Structure |
1D7K; 2ON3; 2OO0; 1F3T; 1QU4; 1SZR; 2TOD
|
||||
| Drugs and Mode of Action | |||||
| Drug(s) | Eflornithine | Drug Info | Approved | African trypanosomiasis | [468237], [536135] |
| Difluoromethylornithine | Drug Info | Phase 2 | Trypanosoma brucei gambiense infection | [523970] | |
| DFMO | Drug Info | Withdrawn from market | Discovery agent | [545498] | |
| Putrescine | Drug Info | Discontinued in Phase 2 | Burns and burn infection | [539518], [547142] | |
| Inhibitor | (2R,5R)-delta-methyl-alpha-acetylenic putrescine | Drug Info | [537732] | ||
| 1-Amino-3-(aminoxy)-2-propanol Dihydrochloride | Drug Info | [531018] | |||
| 3-(Aminooxy)propan-1-amine hydrochloride | Drug Info | [531018] | |||
| 3-aminooxy-1-aminopropane | Drug Info | [528522] | |||
| 3-methoxy-4-hydroxylonchocarpin | Drug Info | [525437] | |||
| 4-hydroxylonchocarpin | Drug Info | [525437] | |||
| Alpha-Difluoromethylornithine | Drug Info | [551393] | |||
| Alpha-monofluoromethyl-3,4-dehydroornithine | Drug Info | [537732] | |||
| Alpha-monofluoromethyl-3,4-dehydroornithine ethyl ester | Drug Info | [537732] | |||
| Alpha-monofluoromethyl-3,4-dehydroornithine methyl ester | Drug Info | [537732] | |||
| AMXT-1501 | Drug Info | [543400] | |||
| APA | Drug Info | [527450] | |||
| DFMO | Drug Info | [534924] | |||
| Difluoromethylornithine | Drug Info | [537878] | |||
| Eflornithine | Drug Info | [537732] | |||
| G418 | Drug Info | [551393] | |||
| LONCHOCARPUSONE | Drug Info | [525437] | |||
| N'-Pyridoxyl-Lysine-5'-Monophosphate | Drug Info | [551393] | |||
| N-Pyridoxyl-Glycine-5-Monophosphate | Drug Info | [551393] | |||
| Putrescine | Drug Info | [551393] | |||
| Pyridoxine-5'-Phosphate | Drug Info | [551393] | |||
| ZAPOTIN | Drug Info | [528622] | |||
| Target Expression Profile (TEP) and Drug Resistance Mutation (DRM) | |||||
| TEP | EXP Info | ||||
| Pathways | |||||
| BioCyc Pathway | Putrescine biosynthesis I | ||||
| NetPath Pathway | TCR Signaling Pathway | ||||
| IL2 Signaling Pathway | |||||
| TGF_beta_Receptor Signaling Pathway | |||||
| PANTHER Pathway | Ornithine degradation | ||||
| CCKR signaling map ST | |||||
| Pathway Interaction Database | Validated targets of C-MYC transcriptional activation | ||||
| PathWhiz Pathway | Spermidine and Spermine Biosynthesis | ||||
| References | |||||
| Ref 468237 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 5176). | ||||
| Ref 523970 | ClinicalTrials.gov (NCT01636128) Urinary Biomarker Study With Sulindac and Difluoromethylornithine. U.S. National Institutes of Health. | ||||
| Ref 536135 | Opportunities and challenges in antiparasitic drug discovery. Nat Rev Drug Discov. 2005 Sep;4(9):727-40. | ||||
| Ref 539518 | (http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Ligand id: 2388). | ||||
| Ref 525437 | J Nat Prod. 1999 Feb;62(2):205-10.New bioactive flavonoids and stilbenes in cub?| resin insecticide. | ||||
| Ref 527450 | 2-substituted 3-(aminooxy)propanamines as inhibitors of ornithine decarboxylase: synthesis and biological activity. J Med Chem. 1992 Apr 17;35(8):1339-44. | ||||
| Ref 528522 | Antimicrob Agents Chemother. 2007 Feb;51(2):528-34. Epub 2006 Nov 13.Antileishmanial effect of 3-aminooxy-1-aminopropane is due to polyamine depletion. | ||||
| Ref 528622 | J Med Chem. 2007 Jan 25;50(2):350-5.Synthesis and cancer chemopreventive activity of zapotin, a natural product from Casimiroa edulis. | ||||
| Ref 531018 | Bioorg Med Chem Lett. 2010 Aug 1;20(15):4364-6. Epub 2010 Jun 17.Selective delivery of 2-hydroxy APA to Trypanosoma brucei using the melamine motif. | ||||
| Ref 534924 | X-ray structure of ornithine decarboxylase from Trypanosoma brucei: the native structure and the structure in complex with alpha-difluoromethylornithine. Biochemistry. 1999 Nov 16;38(46):15174-84. | ||||
| Ref 537732 | Plasmodium falciparum and Plasmodium berghei: effects of ornithine decarboxylase inhibitors on erythrocytic schizogony. Exp Parasitol. 1987 Oct;64(2):237-43. | ||||
| Ref 537878 | An inhibitor of polyamine biosynthesis impairs human polymorphonuclear leukocyte priming by tumor necrosis factor alpha. J Leukoc Biol. 1995 Feb;57(2):282-6. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.
