Target General Infomation
Target ID
T21307
Former ID
TTDI02119
Target Name
MAPKAP kinase 2
Gene Name
MAPKAPK2
Synonyms
MAP kinaseactivated protein kinase 2; MAPKactivated protein kinase 2; MK2; MAPKAPK2
Target Type
Clinical Trial
Disease Autoimmune diabetes [ICD10: E08-E13]
Fibrosis [ICD9: 709.2; ICD10: L90.5]
Inflammatory disease [ICD9: 140-229, 147, 173, 573.3, 710-719; ICD10: C11, C44, K75.9, M00-M25]
Mesothelioma [ICD9: 163; ICD10: C45]
Function
Stress-activated serine/threonine-protein kinase involved in cytokines production, endocytosis, reorganization of the cytoskeleton, cell migration, cell cycle control, chromatin remodeling, DNA damage response and transcriptional regulation. Following stress, it is phosphorylated and activated by MAP kinase p38-alpha/MAPK14, leading to phosphorylation of substrates. Phosphorylates serine in the peptide sequence, Hyd-X-R-X(2)-S, where Hyd is a large hydrophobic residue. Phosphorylates ALOX5, CDC25B, CDC25C, ELAVL1, HNRNPA0, HSF1, HSP27/HSPB1, KRT18, KRT20, LIMK1, LSP1, PABPC1, PARN, PDE4A, RCSD1, RPS6KA3, TAB3 and TTP/ZFP36. Mediates phosphorylation of HSP27/HSPB1 in response to stress, leading to dissociate HSP27/HSPB1 from large small heat- shock protein (sHsps) oligomers and impair their chaperone activities and ability to protect against oxidative stress effectively. Involved in inflammatory response by regulating tumor necrosis factor (TNF) and IL6 production post-transcriptionally: acts by phosphorylating AU-rich elements (AREs)-binding proteins ELAVL1, HNRNPA0, PABPC1 and TTP/ZFP36, leading to regulate the stability and translation of TNF and IL6 mRNAs. Phosphorylation of TTP/ZFP36, a major post-transcriptional regulator of TNF, promotes its binding to 14-3-3 proteins and reduces its ARE mRNA affinity leading to inhibition of dependent degradation of ARE-containing transcript. Also involved in late G2/M checkpoint following DNA damage through a process of post-transcriptional mRNA stabilization: following DNA damage, relocalizes from nucleus to cytoplasm and phosphorylates HNRNPA0 and PARN, leading to stabilize GADD45A mRNA. Involved in toll-like receptor signaling pathway (TLR) in dendritic cells: required for acute TLR-induced macropinocytosis by phosphorylating and activating RPS6KA3.
BioChemical Class
Kinase
UniProt ID
EC Number
EC 2.7.11.1
Sequence
MLSNSQGQSPPVPFPAPAPPPQPPTPALPHPPAQPPPPPPQQFPQFHVKSGLQIKKNAII
DDYKVTSQVLGLGINGKVLQIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRI
VDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAIQYLHSI
NIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEVLGPEKY
DKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKM
LIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSAL
ATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH
Drugs and Mode of Action
Drug(s) CBP-501 Drug Info Phase 1/2 Mesothelioma [522352]
Inhibitor CBP-501 Drug Info [550418]
CMPD1 Drug Info [529123]
compound 16 Drug Info [528819]
compound 16 Drug Info [529760]
compound 33 Drug Info [530078]
MAPKAP kinase 2 inhibitors Drug Info [543553]
MK2 inhibitors Drug Info [543553]
MMI-0100 Drug Info [543553]
PF-3644022 Drug Info [530792]
Research programme: MAP kinase kinase 2 inhibitors, Pfizer Drug Info [543553]
Pathways
KEGG Pathway MAPK signaling pathway
VEGF signaling pathway
Neurotrophin signaling pathway
Viral carcinogenesis
NetPath Pathway IL2 Signaling Pathway
PANTHER Pathway Angiogenesis
Interleukin signaling pathway
PDGF signaling pathway
VEGF signaling pathway
Ras Pathway
p38 MAPK pathway
Pathway Interaction Database IL2-mediated signaling events
p38 signaling mediated by MAPKAP kinases
Signaling mediated by p38-alpha and p38-beta
Signaling events mediated by VEGFR1 and VEGFR2
Trk receptor signaling mediated by the MAPK pathway
Reactome p38MAPK events
Oxidative Stress Induced Senescence
Regulation of HSF1-mediated heat shock response
VEGFA-VEGFR2 Pathway
activated TAK1 mediates p38 MAPK activation
WikiPathways Serotonin Receptor 4/6/7 and NR3C Signaling
Serotonin Receptor 2 and ELK-SRF/GATA4 signaling
Serotonin HTR1 Group and FOS Pathway
p38 MAPK Signaling Pathway
MAPK Signaling Pathway
FAS pathway and Stress induction of HSP regulation
MAP kinase activation in TLR cascade
Regulation of mRNA Stability by Proteins that Bind AU-rich Elements
Arachidonic acid metabolism
Structural Pathway of Interleukin 1 (IL-1)
Regulation of Microtubule Cytoskeleton
IL-1 signaling pathway
NGF signalling via TRKA from the plasma membrane
MAPK targets/ Nuclear events mediated by MAP kinases
References
Ref 522352ClinicalTrials.gov (NCT00700336) Study of CBP501 + Pemetrexed + Cisplatin on MPM (Phase I/II). U.S. National Institutes of Health.
Ref 528819J Med Chem. 2007 May 31;50(11):2647-54. Epub 2007 May 5.Pyrrolopyridine inhibitors of mitogen-activated protein kinase-activated protein kinase 2 (MK-2).
Ref 529123Synthesis and in vivo activity of MK2 and MK2 substrate-selective p38alpha(MAPK) inhibitors in Werner syndrome cells. Bioorg Med Chem Lett. 2007 Dec 15;17(24):6832-5. Epub 2007 Oct 17.
Ref 529760Pyrrolo-pyrimidones: a novel class of MK2 inhibitors with potent cellular activity. Bioorg Med Chem Lett. 2008 Dec 1;18(23):6142-6.
Ref 530078Identification and SAR of squarate inhibitors of mitogen activated protein kinase-activated protein kinase 2 (MK-2). Bioorg Med Chem. 2009 May 1;17(9):3342-51.
Ref 530792A benzothiophene inhibitor of mitogen-activated protein kinase-activated protein kinase 2 inhibits tumor necrosis factor alpha production and has oral anti-inflammatory efficacy in acute and chronic models of inflammation. J Pharmacol Exp Ther. 2010 Jun;333(3):797-807.
Ref 543553(http://www.guidetopharmacology.org/) Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 2094).
Ref 550418National Cancer Institute Drug Dictionary (drug id 577812).

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.