Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET01OUO) | |||||
|---|---|---|---|---|---|
| Name |
Acetylcholine VAChT transporter (SLC18A3)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Vesicular acetylcholine transporter; Solute carrier family 18 member 3; VAChT; rVAT; SLC18A3
|
||||
| Family | Potential-driven transporter (PDT) >> Major facilitator (MF) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | SLC18A3 | Gene ID | |||
| UniProt ID | VACHT_HUMAN | (click to find more protein-related data of this DBT) | |||
| TTD ID | T89772 | (click to find more therapeutic target data of this DBT) | |||
| VARIDT ID | DTD0124 | (click to find more drug transporter data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MESAEPAGQARAAATKLSEAVGAALQEPRRQRRLVLVIVCVALLLDNMLYMVIVPIVPDY
IAHMRGGGEGPTRTPEVWEPTLPLPTPANASAYTANTSASPTAAWPAGSALRPRYPTESE DVKIGVLFASKAILQLLVNPLSGPFIDRMSYDVPLLIGLGVMFASTVLFAFAEDYATLFA ARSLQGLGSAFADTSGIAMIADKYPEEPERSRALGVALAFISFGSLVAPPFGGILYEFAG KRVPFLVLAAVSLFDALLLLAVAKPFSAAARARANLPVGTPIHRLMLDPYIAVVAGALTT CNIPLAFLEPTIATWMKHTMAASEWEMGMAWLPAFVPHVLGVYLTVRLAARYPHLQWLYG ALGLAVIGASSCIVPACRSFAPLVVSLCGLCFGIALVDTALLPTLAFLVDVRHVSVYGSV YAIADISYSVAYALGPIVAGHIVHSLGFEQLSLGMGLANLLYAPVLLLLRNVGLLTRSRS ERDVLLDEPPQGLYDAVRLRERPVSGQDGEPRSPPGPFDACEDDYNYYYTRS |
||||
| Function |
Involved in acetylcholine transport into synaptic vesicles.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: D&C red no. 28 | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
 click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Colorant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 9700 nM (estimated based on the structural similarity with CHEMBL2359093 ) | [1] | ||||
| Structural Similarity | Tanimoto coefficient = 0.857954545 | |||||
| Tested Species | Rattus norvegicus (Rat) | |||||
| UniProt ID | VACHT_RAT | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Rose Bengal analogs and vesicular glutamate transporters (VGLUTs). Bioorg Med Chem. 2010 Sep 15; 18(18):6922-33. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.