Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET03JUR)
Name
Dopamine transporter (DAT)
Synonyms    Click to Show/Hide the Synonyms of This DBT
Sodium-dependent dopamine transporter; DA transporter; DAT; DAT1; Solute carrier family 6 member 3
Family Potential-driven transporter (PDT)  >>  Neurotransmitter:sodium symporter (NSS)
Organism
Homo sapiens (Human)
Gene Name SLC6A3 Gene ID
6531
UniProt ID SC6A3_HUMAN (click to find more protein-related data of this DBT)
TTD ID T55959 (click to find more therapeutic target data of this DBT)
VARIDT ID DTD0455 (click to find more drug transporter data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MSKSKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDR
ETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELAL
GQFNREGAAGVWKICPILKGVGFTVILISLYVGFFYNVIIAWALHYLFSSFTTELPWIHC
NNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPPRWQL
TACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAIDGIRAYLSV
DFYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIVTTSINSLTSFSS
GFVVFSFLGYMAQKHSVPIGDVAKDGPGLIFIIYPEAIATLPLSSAWAVVFFIMLLTLGI
DSAMGGMESVITGLIDEFQLLHRHRELFTLFIVLATFLLSLFCVTNGGIYVFTLLDHFAA
GTSILFGVLIEAIGVAWFYGVGQFSDDIQQMTGQRPSLYWRLCWKLVSPCFLLFVVVVSI
VTFRPPHYGAYIFPDWANALGWVIATSSMAMVPIYAAYKFCSLPGSFREKLAYAIAPEKD
RELVDRGEVRQFTLRHWLKV
Function
Amine transporter. Terminates the action of dopamine by its high affinity sodium-dependent reuptake into presynaptic terminals.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Butylparaben Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 19 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SC6A3_HUMAN
          DIG Name: Cetylpyridinium chloride Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative; Penetration agent; Solubilizing agent; Surfactant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 2.4 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SC6A3_HUMAN
          DIG Name: Quinoline yellow WS Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Colorant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 29 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SC6A3_HUMAN
          DIG Name: Benzethonium chloride Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative; Surfactant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 0.9 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SC6A3_HUMAN
          DIG Name: Hydroxypropyl gamma-cyclodextrin Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Other agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 1687 nM (estimated based on the structural similarity with CHEMBL1629810 ) [2]
                   Structural Similarity Tanimoto coefficient = 1
                   Tested Species Homo sapiens (Human)
                   UniProt ID SC6A3_HUMAN
          DIG Name: Methylene blue Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Colorant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 4.6 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SC6A3_HUMAN
          DIG Name: Phenylmercuric acetate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 1.8 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SC6A3_HUMAN
References
1 The activities of drug inactive ingredients on biological targets. Science. 2020 Jul 24;369(6502):403-413.
2 DrugMatrix in vitro pharmacology data.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.