Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET04RMS) | |||||
---|---|---|---|---|---|
Name |
Thrombopoietin receptor (MPL)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
Myeloproliferative leukemia protein; Proto-oncogene c-Mpl; C-mpl; CD110; CD110 antigen; TPO-R; TPOR
|
||||
Family | Other protein families (OPF) >> Cytokine receptor (CKR) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | MPL | Gene ID | |||
UniProt ID | TPOR_HUMAN | (click to find more protein-related data of this DBT) | |||
TTD ID | T16156 | (click to find more therapeutic target data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MPSWALFMVTSCLLLAPQNLAQVSSQDVSLLASDSEPLKCFSRTFEDLTCFWDEEEAAPS
GTYQLLYAYPREKPRACPLSSQSMPHFGTRYVCQFPDQEEVRLFFPLHLWVKNVFLNQTR TQRVLFVDSVGLPAPPSIIKAMGGSQPGELQISWEEPAPEISDFLRYELRYGPRDPKNST GPTVIQLIATETCCPALQRPHSASALDQSPCAQPTMPWQDGPKQTSPSREASALTAEGGS CLISGLQPGNSYWLQLRSEPDGISLGGSWGSWSLPVTVDLPGDAVALGLQCFTLDLKNVT CQWQQQDHASSQGFFYHSRARCCPRDRYPIWENCEEEEKTNPGLQTPQFSRCHFKSRNDS IIHILVEVTTAPGTVHSYLGSPFWIHQAVRLPTPNLHWREISSGHLELEWQHPSSWAAQE TCYQLRYTGEGHQDWKVLEPPLGARGGTLELRPRSRYRLQLRARLNGPTYQGPWSSWSDP TRVETATETAWISLVTALHLVLGLSAVLGLLLLRWQFPAHYRRLRHALWPSLPDLHRVLG QYLRDTAALSPPKATVSDTCEEVEPSLLEILPKSSERTPLPLCSSQAQMDYRRLQPSCLG TMPLSVCPPMAESGSCCTTHIANHSYLPLSYWQQP |
||||
Function |
May represent a regulatory molecule specific for TPO-R-dependent immune responses. Receptor for thrombopoietin that acts as a primary regulator of megakaryopoiesis and platelet production.
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Allura red AC dye | Click to Show/Hide | |||||
Detailed Information | DIG Info click to show the detail info of this DIG | |||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Colorant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | EC50 = 300 nM (estimated based on the structural similarity with CHEMBL123373 ) | [1] | ||||
Structural Similarity | Tanimoto coefficient = 0.925714286 | |||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | TPOR_HUMAN | |||||
DIG Name: Silotermo carmine G | Click to Show/Hide | |||||
Detailed Information | DIG Info click to show the detail info of this DIG | |||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Colorant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | EC50 = 10000 nM (estimated based on the structural similarity with CHEMBL331220 ) | [1] | ||||
Structural Similarity | Tanimoto coefficient = 0.886010363 | |||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | TPOR_HUMAN | |||||
DIG Name: Sunset yellow FCF | Click to Show/Hide | |||||
Detailed Information | DIG Info click to show the detail info of this DIG | |||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Colorant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | EC50 = 3000 nM (estimated based on the structural similarity with CHEMBL122867 ) | [1] | ||||
Structural Similarity | Tanimoto coefficient = 0.93081761 | |||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | TPOR_HUMAN | |||||
References | |||||
---|---|---|---|---|---|
1 | Hydrazinonaphthalene and azonaphthalene thrombopoietin mimics are nonpeptidyl promoters of megakaryocytopoiesis. J Med Chem. 2001 Oct 25; 44(22):3730-45. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.