Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET05LSS) | |||||
---|---|---|---|---|---|
Name |
Serine racemase (SRR)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase
|
||||
Family | Lyase/isomerase/ligase (L/I/G) >> Racemase/epimerase (EC 5.1) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | SRR | Gene ID | |||
UniProt ID | SRR_HUMAN | (click to find more protein-related data of this DBT) | |||
TTD ID | T00477 | (click to find more therapeutic target data of this DBT) | |||
INTEDE ID | DME0588 | (click to find more drug-metabolizing enzyme data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGA
LNAVRSLVPDALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQA YGASIVYCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDAL VVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGV KSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKLLIEPTAGVGVAAVLSQHFQT VSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQSVSV |
||||
Function |
D-serine is a key coagonist with glutamate at NMDA receptors. Has dehydratase activity towards both L-serine and D-serine. Catalyzes the synthesis of D-serine from L-serine.
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Aminoethanoic acid | Click to Show/Hide | |||||
Detailed Information | DIG Info click to show the detail info of this DIG | |||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Buffering agent; Disintegrant; Lyophilization aid
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Ki = 366000 nM (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | SRR_HUMAN | |||||
References | |||||
---|---|---|---|---|---|
1 | In silico and pharmacological screenings identify novel serine racemase inhibitors. Bioorg Med Chem Lett. 2014 Aug 15; 24(16):3732-5. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.