Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET07LSR) | |||||
---|---|---|---|---|---|
Name |
Tyrosyl-DNA phosphodiesterase 2 (TDP2)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
TRAF and TNF receptor-associated protein; Tyr-DNA phosphodiesterase 2; Tyrosyl-RNA phosphodiesterase; VPg unlinkase; 5'-Tyr-DNA phosphodiesterase; 5'-tyrosyl-DNA phosphodiesterase; EAPII; ETS1-associated protein 2; ETS1-associated protein II; TDP2; hTDP2
|
||||
Family | Hydrolase (HDase) >> Ester bond hydrolase (EC 3.1) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | TDP2 | Gene ID | |||
UniProt ID | TYDP2_HUMAN | (click to find more protein-related data of this DBT) | |||
TTD ID | T04696 | (click to find more therapeutic target data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MELGSCLEGGREAAEEEGEPEVKKRRLLCVEFASVASCDAAVAQCFLAENDWEMERALNS
YFEPPVEESALERRPETISEPKTYVDLTNEETTDSTTSKISPSEDTQQENGSMFSLITWN IDGLDLNNLSERARGVCSYLALYSPDVIFLQEVIPPYYSYLKKRSSNYEIITGHEEGYFT AIMLKKSRVKLKSQEIIPFPSTKMMRNLLCVHVNVSGNELCLMTSHLESTRGHAAERMNQ LKMVLKKMQEAPESATVIFAGDTNLRDREVTRCGGLPNNIVDVWEFLGKPKHCQYTWDTQ MNSNLGITAACKLRFDRIFFRAAAEEGHIIPRSLDLLGLEKLDCGRFPSDHWGLLCNLDI IL |
||||
Function |
DNA repair enzyme that can remove a variety of covalent adducts from DNA through hydrolysis of a 5'-phosphodiester bond, giving rise to DNA with a free 5' phosphate. Catalyzes the hydrolysis of dead-end complexes between DNA and the topoisomerase 2 (TOP2) active site tyrosine residue. Hydrolyzes 5'- phosphoglycolates on protruding 5' ends on DNA double-strand breaks (DSBs) due to DNA damage by radiation and free radicals.
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Hydrazine yellow | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Colorant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 3500 nM (estimated based on the structural similarity with CHEMBL3813826 ) | [1] | ||||
Structural Similarity | Tanimoto coefficient = 0.777777778 | |||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | TYDP2_HUMAN | |||||
References | |||||
---|---|---|---|---|---|
1 | Discovery of selective inhibitors of tyrosyl-DNA phosphodiesterase 2 by targeting the enzyme DNA-binding cleft. Bioorg Med Chem Lett. 2016 Jul 15; 26(14):3232-3236. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.