Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET08KAW)
Name
Factor HNF-4-alpha (HNF4A)
Synonyms    Click to Show/Hide the Synonyms of This DBT
Hepatocyte nuclear factor 4-alpha; HNF-4-alpha; HNF4; NR2A1; Nuclear receptor subfamily 2 group A member 1; TCF-14; TCF14; Transcription factor 14; Transcription factor HNF-4
Family Nuclear receptor (NR)  >>  Nuclear hormone receptor (NHR)
Organism
Homo sapiens (Human)
Gene Name HNF4A Gene ID
3172
UniProt ID HNF4A_HUMAN (click to find more protein-related data of this DBT)
TTD ID T15514 (click to find more therapeutic target data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSALC
AICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKC
FRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQAEVLSRQITSPVSGINGDIRAKK
IASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGATKRSMVFK
DVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAK
GLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKL
FGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEW
PRPRGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEVI
Function
Activates the transcription of CYP2C38. Represses the CLOCK-ARNTL/BMAL1 transcriptional activity and is essential for circadian rhythm maintenance and period regulation in the liver and colon cells. Transcriptional regulator which controls the expression of hepatic genes during the transition of endodermal cells to hepatic progenitor cells, facilitating the recruitment of RNA pol II to the promoters of target genes.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Kyselina citronova Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Acidulant; Antioxidant; Buffering agent; Complexing agent; Flavoring agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 39869 nM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID HNF4A_HUMAN
          DIG Name: Denatonium benzoate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Alcohol denaturant; Flavoring agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 39845 nM (estimated based on the structural similarity with CHEMBL1506851 ) [1]
                   Structural Similarity Tanimoto coefficient = 0.875862069
                   Tested Species Homo sapiens (Human)
                   UniProt ID HNF4A_HUMAN
References
1 PubChem BioAssay data set.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.