Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET0AY2J) | |||||
---|---|---|---|---|---|
Name |
Nuclear receptor ROR-gamma (RORC)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
Nuclear receptor RZR-gamma; Nuclear receptor subfamily 1 group F member 3; RAR-related orphan receptor C; RORG; RZRG; NR1F3; Retinoid-related orphan receptor-gamma
|
||||
Family | Nuclear receptor (NR) >> Nuclear hormone receptor (NHR) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | RORC | Gene ID | |||
UniProt ID | RORG_HUMAN | (click to find more protein-related data of this DBT) | |||
TTD ID | T25307 | (click to find more therapeutic target data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQR
CNAAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQK QLQQRQQQQQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKAS GSGPSYSNNLAKAGLNGASCHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPG LGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIF SREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEV VLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALY TALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHV ERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLSK |
||||
Function |
Nuclear receptor that binds DNA as a monomer to ROR response elements (RORE) containing a single core motif half-site 5'-AGGTCA-3' preceded by a short A-T-rich sequence. Key regulator of cellular differentiation, immunity, peripheral circadian rhythm as well as lipid, steroid, xenobiotics and glucose metabolism. Considered to have intrinsic transcriptional activity, have some natural ligands like oxysterols that act as agonists (25-hydroxycholesterol) or inverse agonists (7-oxygenated sterols).
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Cholesterol | Click to Show/Hide | |||||
Detailed Information | DIG Info click to show the detail info of this DIG | |||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Emollient; Emulsifying agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | EC50 = 20 nM (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | RORG_HUMAN | |||||
References | |||||
---|---|---|---|---|---|
1 | Retinoic Acid Receptor-Related Orphan Receptor t (RORt) Agonists as Potential Small Molecule Therapeutics for Cancer Immunotherapy. J Med Chem. 2018 Jul 26; 61(14):5794-5804. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.