Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET0C2HU)
Name
Adenosine receptor A2b (AA2BR)
Synonyms    Click to Show/Hide the Synonyms of This DBT
Adenosine A2B receptor; A2bR; ADORA2B; A2b Adenosine receptor; A(2B) adenosine receptor
Family G-protein coupled receptor (GPCR)  >>  G-protein coupled rhodopsin receptor (GPCR-A)
Organism
Homo sapiens (Human)
Gene Name ADORA2B Gene ID
136
UniProt ID AA2BR_HUMAN (click to find more protein-related data of this DBT)
TTD ID T86679 (click to find more therapeutic target data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFA
IPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGT
RARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMS
YMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIV
GIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYT
FHKIISRYLLCQADVKSGNGQAGVQPALGVGL
Function
The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Receptor for adenosine.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Caffeine Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Other agent
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 10000 nM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID AA2BR_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 23000 nM (tested by experiment) [2]
                   Tested Species Mus musculus (Mouse)
                   UniProt ID AA2BR_MOUSE
             Experiment (3) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 30000 nM (tested by experiment) [2]
                   Tested Species Rattus norvegicus (Rat)
                   UniProt ID AA2BR_RAT
References
1 Novel non-xanthine antagonist of the A 2B adenosine receptor: From HTS hit to lead structure. Eur J Med Chem. 2019 Feb 1; 163:763-778.
2 Fluorescent-Labeled Selective Adenosine A 2B Receptor Antagonist Enables Competition Binding Assay by Flow Cytometry. J Med Chem. 2018 May 24; 61(10):4301-4316.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.