Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET0I0TS) | |||||
|---|---|---|---|---|---|
| Name |
Pancreatic lipase (PTL)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Pancreatic triacylglycerol lipase; PNLIP; PL; PTL
|
||||
| Family | Hydrolase (HDase) >> Ester bond hydrolase (EC 3.1) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | PNLIP | Gene ID | |||
| UniProt ID | LIPP_HUMAN | (click to find more protein-related data of this DBT) | |||
| TTD ID | T94309 | (click to find more therapeutic target data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MLPLWTLSLLLGAVAGKEVCYERLGCFSDDSPWSGITERPLHILPWSPKDVNTRFLLYTN
ENPNNFQEVAADSSSISGSNFKTNRKTRFIIHGFIDKGEENWLANVCKNLFKVESVNCIC VDWKGGSRTGYTQASQNIRIVGAEVAYFVEFLQSAFGYSPSNVHVIGHSLGAHAAGEAGR RTNGTIGRITGLDPAEPCFQGTPELVRLDPSDAKFVDVIHTDGAPIVPNLGFGMSQVVGH LDFFPNGGVEMPGCKKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIVNPDGFAGF PCASYNVFTANKCFPCPSGGCPQMGHYADRYPGKTNDVGQKFYLDTGDASNFARWRYKVS VTLSGKKVTGHILVSLFGNKGNSKQYEIFKGTLKPDSTHSNEFDSDVDVGDLQMVKFIWY NNVINPTLPRVGASKIIVETNVGKQFNFCSPETVREEVLLTLTPC |
||||
| Function |
Plays an important role in fat metabolism. It preferentially splits the esters of long-chain fatty acids at positions 1 and 3, producing mainly 2-monoacylglycerol and free fatty acids, and shows considerably higher activity against insoluble emulsified substrates than against soluble ones.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: Vanillin | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
 click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Flavoring agent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 74400 nM (tested by experiment) | [1] | ||||
| Tested Species | Sus scrofa (Pig) | |||||
| UniProt ID | LIPP_PIG | |||||
| References | |||||
|---|---|---|---|---|---|
| 1 | Enhancement of pancreatic lipase inhibitory activity of curcumin by radiolytic transformation. Bioorg Med Chem Lett. 2011 Mar 1; 21(5):1512-4. | ||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.