General Information of DBT (ID: ET0V5KB)
Name
Organic anion transporter 6 (OAT6)
Synonyms    Click to Show/Hide the Synonyms of This DBT
Solute carrier family 22 member 20; Solute carrier family 22 member 20 pseudogene; SLC22A20; SLC22A20P
Family Potential-driven transporter (PDT)  >>  Major facilitator (MF)
Organism
Homo sapiens (Human)
Gene Name SLC22A20P Gene ID
440044
UniProt ID S22AK_HUMAN (click to find more protein-related data of this DBT)
VARIDT ID DTD0145 (click to find more drug transporter data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MAFTDLLDALGSMGRFQLNHTALLLLPCGLLACHNFLQNFTAAVPPHHCRGPANHTEAST
NDSGAWLRATIPLDQLGAPEPCRRFTKPQWALLSPNSSIPGAATEGCKDGWVYNRSVFPS
TIVMEWDLVCEARTLRDLAQSVYMAGVLVGAAVFGSLADRLGCKGPLVWSYLQLAASGAA
TAYFSSFSAYCVFRFLMGMTFSGIILNSVSLVVEWMPTRGRTVAGILLGYSFTLGQLILA
GVAYLIRPWRCLQFAISAPFLIFFLYSWWLPESSRWLLLHGKSQLAVQNLQKVAAMNGRK
EEGERLTKEVMSSYIQSEFASVCTSNSILDLFRTPAIRKVTCCLMVIWFSNSVAYYGLAM
DLQKFGLSLYLVQALFGIINTPAMLVATATMIYVGRRATVASFLILAGLMVIANMFVPEG
TQILCTAQAALGKGCLASSFICVYLFTGELYPTEIRQMGMGFASVHARLGGLTAPLVTTL
GEYSTILPPVSFGATAILAGLAVCVLTETRNMPLVETIAAMERRVKEGSSKKHVEEKSEE
ISLQQLRASPLKETI
Function
Organic anion transporter that mediates the uptake of estrone sulfate. Inhibited by probenecid, propionate, 2-methylbutyrate, 3-methylbutyrate, benzoate, heptanoate and 2-ethylhaxanoate. May act as an odorant transporter.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Benzoic acid Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 13800 nM (tested by experiment) [1]
                   Tested Species Mus musculus (Mouse)
                   UniProt ID S22AK_MOUSE
          DIG Name: D&C red no. 22 Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Colorant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 4365.16 nM (estimated based on the structural similarity with CHEMBL376503 ) [1]
                   Structural Similarity Tanimoto coefficient = 1
                   Tested Species Mus musculus (Mouse)
                   UniProt ID S22AK_MOUSE
          DIG Name: Sodium stearate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Gelling agent; Glidant; Modified-release agent; Stiffening agent; lubricant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 8128.31 nM (estimated based on the structural similarity with CHEMBL320358 ) [1]
                   Structural Similarity Tanimoto coefficient = 1
                   Tested Species Mus musculus (Mouse)
                   UniProt ID S22AK_MOUSE
          DIG Name: Propionic acid Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Acidulant; Antimicrobial preservative; Antioxidant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 279000 nM (tested by experiment) [1]
                   Tested Species Mus musculus (Mouse)
                   UniProt ID S22AK_MOUSE
References
1 Structural variation governs substrate specificity for organic anion transporter (OAT) homologs. Potential remote sensing by OAT family members. J Biol Chem. 2007 Aug 17; 282(33):23841-53.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.