Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET0V5KB) | |||||
---|---|---|---|---|---|
Name |
Organic anion transporter 6 (OAT6)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
Solute carrier family 22 member 20; Solute carrier family 22 member 20 pseudogene; SLC22A20; SLC22A20P
|
||||
Family | Potential-driven transporter (PDT) >> Major facilitator (MF) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | SLC22A20P | Gene ID | |||
UniProt ID | S22AK_HUMAN | (click to find more protein-related data of this DBT) | |||
VARIDT ID | DTD0145 | (click to find more drug transporter data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MAFTDLLDALGSMGRFQLNHTALLLLPCGLLACHNFLQNFTAAVPPHHCRGPANHTEAST
NDSGAWLRATIPLDQLGAPEPCRRFTKPQWALLSPNSSIPGAATEGCKDGWVYNRSVFPS TIVMEWDLVCEARTLRDLAQSVYMAGVLVGAAVFGSLADRLGCKGPLVWSYLQLAASGAA TAYFSSFSAYCVFRFLMGMTFSGIILNSVSLVVEWMPTRGRTVAGILLGYSFTLGQLILA GVAYLIRPWRCLQFAISAPFLIFFLYSWWLPESSRWLLLHGKSQLAVQNLQKVAAMNGRK EEGERLTKEVMSSYIQSEFASVCTSNSILDLFRTPAIRKVTCCLMVIWFSNSVAYYGLAM DLQKFGLSLYLVQALFGIINTPAMLVATATMIYVGRRATVASFLILAGLMVIANMFVPEG TQILCTAQAALGKGCLASSFICVYLFTGELYPTEIRQMGMGFASVHARLGGLTAPLVTTL GEYSTILPPVSFGATAILAGLAVCVLTETRNMPLVETIAAMERRVKEGSSKKHVEEKSEE ISLQQLRASPLKETI |
||||
Function |
Organic anion transporter that mediates the uptake of estrone sulfate. Inhibited by probenecid, propionate, 2-methylbutyrate, 3-methylbutyrate, benzoate, heptanoate and 2-ethylhaxanoate. May act as an odorant transporter.
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Benzoic acid | Click to Show/Hide | |||||
Detailed Information | DIG Info click to show the detail info of this DIG | |||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Ki = 13800 nM (tested by experiment) | [1] | ||||
Tested Species | Mus musculus (Mouse) | |||||
UniProt ID | S22AK_MOUSE | |||||
DIG Name: D&C red no. 22 | Click to Show/Hide | |||||
Detailed Information | DIG Info click to show the detail info of this DIG | |||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Colorant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Ki = 4365.16 nM (estimated based on the structural similarity with CHEMBL376503 ) | [1] | ||||
Structural Similarity | Tanimoto coefficient = 1 | |||||
Tested Species | Mus musculus (Mouse) | |||||
UniProt ID | S22AK_MOUSE | |||||
DIG Name: Sodium stearate | Click to Show/Hide | |||||
Detailed Information | DIG Info click to show the detail info of this DIG | |||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Gelling agent; Glidant; Modified-release agent; Stiffening agent; lubricant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Ki = 8128.31 nM (estimated based on the structural similarity with CHEMBL320358 ) | [1] | ||||
Structural Similarity | Tanimoto coefficient = 1 | |||||
Tested Species | Mus musculus (Mouse) | |||||
UniProt ID | S22AK_MOUSE | |||||
DIG Name: Propionic acid | Click to Show/Hide | |||||
Detailed Information | DIG Info click to show the detail info of this DIG | |||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Acidulant; Antimicrobial preservative; Antioxidant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Ki = 279000 nM (tested by experiment) | [1] | ||||
Tested Species | Mus musculus (Mouse) | |||||
UniProt ID | S22AK_MOUSE | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.