Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET0YQ0C)
Name
Olfactory receptor 51E2 (OR51E2)
Synonyms    Click to Show/Hide the Synonyms of This DBT
Olfactory receptor OR11-16; HPRAJ; Prostate-specific G-protein coupled receptor
Family G-protein coupled receptor (GPCR)  >>  G-protein coupled rhodopsin receptor (GPCR-A)
Organism
Homo sapiens (Human)
Gene Name OR51E2 Gene ID
81285
UniProt ID O51E2_HUMAN (click to find more protein-related data of this DBT)
TTD ID T31060 (click to find more therapeutic target data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MSSCNFTHATFVLIGIPGLEKAHFWVGFPLLSMYVVAMFGNCIVVFIVRTERSLHAPMYL
FLCMLAAIDLALSTSTMPKILALFWFDSREISFEACLTQMFFIHALSAIESTILLAMAFD
RYVAICHPLRHAAVLNNTVTAQIGIVAVVRGSLFFFPLPLLIKRLAFCHSNVLSHSYCVH
QDVMKLAYADTLPNVVYGLTAILLVMGVDVMFISLSYFLIIRTVLQLPSKSERAKAFGTC
VSHIGVVLAFYVPLIGLSVVHRFGNSLHPIVRVVMGDIYLLLPPVINPIIYGAKTKQIRT
RVLAMFKISCDKDLQAVGGK
Function
Olfactory receptor. Activated by the odorant, beta-ionone, a synthetic terpenoid. The activity of this receptor is propably mediated by G-proteins leading to the elevation of intracellular Ca(2+), cAMP and activation of the protein kinases PKA and MAPK3/MAPK1. Stimulation of OR51E2 by beta-ionone affects melanocyte proliferation, differentiation, and melanogenesis. Activation of OR51E2 by beta-ionone increases proliferation and migration of primary retinal pigment epithelial (RPE) cells.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Aluminum hydroxide-glycine Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Other agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 58 nM (estimated based on the structural similarity with CHEMBL773 ) [1]
                   Structural Similarity Tanimoto coefficient = 0.870967742
                   Tested Species Homo sapiens (Human)
                   UniProt ID O51E2_HUMAN
          DIG Name: D-tartaric acid Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Acidulant; Complexing agent; Flavoring agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 1.9 nM (estimated based on the structural similarity with CHEMBL4556656 ) [1]
                   Structural Similarity Tanimoto coefficient = 0.846153846
                   Tested Species Homo sapiens (Human)
                   UniProt ID O51E2_HUMAN
          DIG Name: Palmitic acid Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Penetration agent; lubricant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 9.8 nM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID O51E2_HUMAN
          DIG Name: Creatinine Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Other agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 0.0076 nM (estimated based on the structural similarity with CHEMBL2447922 ) [1]
                   Structural Similarity Tanimoto coefficient = 0.755555556
                   Tested Species Homo sapiens (Human)
                   UniProt ID O51E2_HUMAN
          DIG Name: Isostearic acid Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Surfactant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 9.8 nM (estimated based on the structural similarity with CHEMBL82293 ) [1]
                   Structural Similarity Tanimoto coefficient = 0.886363636
                   Tested Species Homo sapiens (Human)
                   UniProt ID O51E2_HUMAN
          DIG Name: Lactobionic acid Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antioxidant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 1000 nM (estimated based on the structural similarity with CHEMBL4590792 ) [1]
                   Structural Similarity Tanimoto coefficient = 0.924242424
                   Tested Species Homo sapiens (Human)
                   UniProt ID O51E2_HUMAN
          DIG Name: Versetamide Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Other agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 11000 nM (estimated based on the structural similarity with CHEMBL292467 ) [1]
                   Structural Similarity Tanimoto coefficient = 0.767857143
                   Tested Species Homo sapiens (Human)
                   UniProt ID O51E2_HUMAN
References
1 US patent application no. 20180116992A1, Modulators of Prostate-Specific G-Protein Receptor (PSGR/OR51E2) and Methods of Using Same.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.