Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET09MPK)
Name
PPAR-delta (PPARD)
Synonyms    Click to Show/Hide the Synonyms of This DBT
Peroxisome proliferator-activated receptor delta; NR1C2; NUC1; NUCI; Nuclear hormone receptor 1; Nuclear receptor subfamily 1 group C member 2; PPAR-beta; PPAR-delta; PPARB; PPARdelta; Peroxisome proliferator-activated receptor beta; Peroxisomeproliferator activated receptor beta/delta; Peroxisomeproliferator-activated receptor beta
Family Nuclear receptor (NR)  >>  Nuclear hormone receptor (NHR)
Organism
Homo sapiens (Human)
Gene Name PPARD Gene ID
5467
UniProt ID PPARD_HUMAN (click to find more protein-related data of this DBT)
TTD ID T36557 (click to find more therapeutic target data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQM
GCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKK
NRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSK
HIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKE
ISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNK
DGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGD
RPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRI
KKTETETSLHPLLQEIYKDMY
Function
Receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Has a preference for poly-unsaturated fatty acids, such as gamma-linoleic acid and eicosapentanoic acid. Once activated by a ligand, the receptor binds to promoter elements of target genes. Regulates the peroxisomal beta-oxidation pathway of fatty acids. Functions as transcription activator for the acyl-CoA oxidase gene. Decreases expression of NPC1L1 once activated by a ligand. Ligand-activated transcription factor.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Dimethyl benzyl carbinyl acetate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Adsorbent; Flavoring agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 16000 nM (estimated based on the structural similarity with CHEMBL1257776 ) [1]
                   Structural Similarity Tanimoto coefficient = 0.850574713
                   Tested Species Mus musculus (Mouse)
                   UniProt ID PPARD_MOUSE
          DIG Name: Myristic acid Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Penetration agent; lubricant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 24000 nM (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID PPARD_HUMAN
          DIG Name: Oleic acid Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Penetration agent; Solubilizing agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 5300 nM (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID PPARD_HUMAN
          DIG Name: Palmitic acid Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Penetration agent; lubricant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 7400 nM (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID PPARD_HUMAN
          DIG Name: Sodium stearate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Gelling agent; Glidant; Modified-release agent; Stiffening agent; lubricant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 30000 nM (estimated based on the structural similarity with CHEMBL1173381 ) [2]
                   Structural Similarity Tanimoto coefficient = 1
                   Tested Species Homo sapiens (Human)
                   UniProt ID PPARD_HUMAN
          DIG Name: Stearic acid Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Solubilizing agent; Viscosity-controlling agent; lubricant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 6000 nM (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID PPARD_HUMAN
          DIG Name: Lauric acid Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antifoaming agent; Emulsifying agent; Lubricant; Penetration agent; Surfactant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 30000 nM (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID PPARD_HUMAN
          DIG Name: Linoleic acid Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Penetration agent; Solubilizing agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 10000 nM (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID PPARD_HUMAN
References
1 A stereo-controlled synthesis of 2,4-dimethyl-4-hydroxy-16-phenylhexadecanoic acid 1,4-lactone and its PPAR activities. Bioorg Med Chem Lett. 2010 Oct 15; 20(20):6017-9.
2 Molecular properties of fatty acids related to PPAR binding and metabolic diseases. Med Chem Res (2013) 22:3126-3133.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.