Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET04UQO)
Name
Organic anion transporter 1 (OAT1)
Synonyms    Click to Show/Hide the Synonyms of This DBT
Solute carrier family 22 member 6; Kidney-specific transport protein; Novel kidney transcript; PAH transporter; Renal organic anion transporter 1; hOAT1; hPAHT; hROAT1; mNKT; mROAT1; SLC22A6
Family Potential-driven transporter (PDT)  >>  Major facilitator (MF)
Organism
Homo sapiens (Human)
Gene Name SLC22A6 Gene ID
9356
UniProt ID S22A6_HUMAN (click to find more protein-related data of this DBT)
VARIDT ID DTD0024 (click to find more drug transporter data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MAFNDLLQQVGGVGRFQQIQVTLVVLPLLLMASHNTLQNFTAAIPTHHCRPPADANLSKN
GGLEVWLPRDRQGQPESCLRFTSPQWGLPFLNGTEANGTGATEPCTDGWIYDNSTFPSTI
VTEWDLVCSHRALRQLAQSLYMVGVLLGAMVFGYLADRLGRRKVLILNYLQTAVSGTCAA
FAPNFPIYCAFRLLSGMALAGISLNCMTLNVEWMPIHTRACVGTLIGYVYSLGQFLLAGV
AYAVPHWRHLQLLVSAPFFAFFIYSWFFIESARWHSSSGRLDLTLRALQRVARINGKREE
GAKLSMEVLRASLQKELTMGKGQASAMELLRCPTLRHLFLCLSMLWFATSFAYYGLVMDL
QGFGVSIYLIQVIFGAVDLPAKLVGFLVINSLGRRPAQMAALLLAGICILLNGVIPQDQS
IVRTSLAVLGKGCLAASFNCIFLYTGELYPTMIRQTGMGMGSTMARVGSIVSPLVSMTAE
LYPSMPLFIYGAVPVAASAVTVLLPETLGQPLPDTVQDLESRWAPTQKEAGIYPRKGKQT
RQQQEHQKYMVPLQASAQEKNGL
Function
Involved in the renal elimination of endogenous and exogenous organic anions. Functions as organic anion exchanger when the uptake of one molecule of organic anion is coupled with an efflux of one molecule of endogenous dicarboxylic acid (glutarate, ketoglutarate, etc). Mediates the sodium-independent uptake of 2,3-dimercapto-1-propanesulfonic acid (DMPS), cidofovir, adefovir, 9-(2-phosphonylmethoxyethyl) guanine (PMEG), 9-(2-phosphonylmethoxyethyl) diaminopurine (PMEDAP), ochratoxin (OTA).
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Adipic acid Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Acidulant; Buffering agent; Flavoring agent; Modified-release agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 407.38 nM (tested by experiment) [1]
                   Tested Species Mus musculus (Mouse)
                   UniProt ID S22A6_MOUSE
          DIG Name: Benzoic acid Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 251188.64 nM (tested by experiment) [1]
                   Tested Species Mus musculus (Mouse)
                   UniProt ID S22A6_MOUSE
          DIG Name: D&C red no. 22 Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Colorant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 89.13 nM (estimated based on the structural similarity with CHEMBL376503 ) [1]
                   Structural Similarity Tanimoto coefficient = 1
                   Tested Species Mus musculus (Mouse)
                   UniProt ID S22A6_MOUSE
          DIG Name: D&C red no. 28 Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Colorant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 0.064 uM (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID S22A6_HUMAN
          DIG Name: Sodium stearate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Gelling agent; Glidant; Modified-release agent; Stiffening agent; lubricant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 33884.42 nM (estimated based on the structural similarity with CHEMBL1162491 ) [1]
                   Structural Similarity Tanimoto coefficient = 1
                   Tested Species Mus musculus (Mouse)
                   UniProt ID S22A6_MOUSE
References
1 Structural variation governs substrate specificity for organic anion transporter (OAT) homologs. Potential remote sensing by OAT family members. J Biol Chem. 2007 Aug 17; 282(33):23841-53.
2 The activities of drug inactive ingredients on biological targets. Science. 2020 Jul 24;369(6502):403-413.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.