Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET0LZ9D) | |||||
---|---|---|---|---|---|
Name |
Glutamate receptor AMPA 4 (GRIA4)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
AMPA-selective glutamate receptor 4; AMPAselective glutamate receptor 4; GRIA4; GluA4; GluR-4; GluR-D; GluR4; GluRD; Glutamate receptor ionotropic, AMPA 4
|
||||
Family | Transmembrane channel/porin (TC/P) >> Glutamate-gated ion channel (GIC) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | GRIA4 | Gene ID | |||
UniProt ID | GRIA4_HUMAN | (click to find more protein-related data of this DBT) | |||
TTD ID | T96235 | (click to find more therapeutic target data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MRIISRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEA
PFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITP SFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWH VSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIA NLGFKDISLERFIHGGANVTGFQLVDFNTPMVIKLMDRWKKLDQREYPGSETPPKYTSAL TYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGN VQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVVVT TIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTK IWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL DPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLW FSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAED LAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKG KFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRTPVNLAVLKLSEAGV LDKLKNKWWYDKGECGPKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKS RAEAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCPKAVHTGTAIRQSSGLAVIASD LP |
||||
Function |
Receptor for glutamate that functions as ligand-gated ion channel in the central nervous system and plays an important role in excitatory synaptic transmission. L-glutamate acts as an excitatory neurotransmitter at many synapses in the centralnervous system. Binding of the excitatory neurotransmitter L- glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse.
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Glutamic acid hydrochloride | Click to Show/Hide | |||||
Detailed Information | DIG Info click to show the detail info of this DIG | |||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Acidulant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Ki = 354 nM (estimated based on the structural similarity with CHEMBL575060 ) | [1] | ||||
Structural Similarity | Tanimoto coefficient = 1 | |||||
Tested Species | Rattus norvegicus (Rat) | |||||
UniProt ID | GRIA4_RAT | |||||
DIG Name: Monosodium glutamate | Click to Show/Hide | |||||
Detailed Information | DIG Info click to show the detail info of this DIG | |||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Buffering agent; Flavoring agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Ki = 868 nM (estimated based on the structural similarity with CHEMBL575060 ) | [2] | ||||
Structural Similarity | Tanimoto coefficient = 0.979166667 | |||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | GRIA4_HUMAN | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.