Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET0P7FB)
Name
Monoamine oxidase A (MAO-A)
Synonyms    Click to Show/Hide the Synonyms of This DBT
Monoamine oxidase A; Amine oxidase [flavin-containing] A; Monoamine oxidase type A; MAO-A
Family Oxidoreductase (ORase)  >>  CH-NH2 donor oxidoreductase (EC 1.4)
Organism
Homo sapiens (Human)
Gene Name MAOA Gene ID
4128
UniProt ID AOFA_HUMAN (click to find more protein-related data of this DBT)
TTD ID T83875 (click to find more therapeutic target data of this DBT)
INTEDE ID DME0044 (click to find more drug-metabolizing enzyme data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MENQEKASIAGHMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHV
DYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA
YLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNI
NVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSERIMDLLGDQVKL
NHPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPM
GAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADR
LAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLGKVTEKDIWVQEPESKD
VPAVEITHTFWERNLPSVSGLLKIIGFSTSVTALGFVLYKYKLLPRS
Function
MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine. Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: FD&C blue no. 2 Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Colorant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 > 3 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID AOFA_HUMAN
          DIG Name: Caffeine Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Other agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 > 50000 nM (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID AOFA_HUMAN
          DIG Name: Hydroxypropyl gamma-cyclodextrin Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Other agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 167 nM (estimated based on the structural similarity with CHEMBL1629810 ) [3]
                   Structural Similarity Tanimoto coefficient = 1
                   Tested Species Homo sapiens (Human)
                   UniProt ID AOFA_HUMAN
          DIG Name: Methylene blue Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Colorant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 70 nM (tested by experiment) [4]
                   Tested Species Homo sapiens (Human)
                   UniProt ID AOFA_HUMAN
          DIG Name: Phenylmercuric acetate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 6.6 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID AOFA_HUMAN
          DIG Name: Thimerosal Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 9.7 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID AOFA_HUMAN
References
1 The activities of drug inactive ingredients on biological targets. Science. 2020 Jul 24;369(6502):403-413.
2 8-Substituted 1,3-dimethyltetrahydropyrazino[2,1-f]purinediones: Water-soluble adenosine receptor antagonists and monoamine oxidase B inhibitors. Bioorg Med Chem. 2016 Nov 1; 24(21):5462-5480.
3 DrugMatrix in vitro pharmacology data.
4 The evaluation of 1,4-benzoquinones as inhibitors of human monoamine oxidase. Eur J Med Chem. 2017 Jul 28; 135:196-203.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.