Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET0SZ6G)
Name
Solute carrier SLCO1A2 (OATP-A)
Synonyms    Click to Show/Hide the Synonyms of This DBT
Sodium-independent organic anion transporter; OATP; OATP-1; OATP-A; OATP1A2; Organic anion-transporting polypeptide 1; SLC21A3; Sodium-independent organic anion transporter; Solute carrier family 21 member 3; Solute carrier organic anion transporter family member 1A2
Family Potential-driven transporter (PDT)  >>  Organo anion transporter (OAT)
Organism
Homo sapiens (Human)
Gene Name SLCO1A2 Gene ID
6579
UniProt ID SO1A2_HUMAN (click to find more protein-related data of this DBT)
TTD ID T00569 (click to find more therapeutic target data of this DBT)
VARIDT ID DTD0029 (click to find more drug transporter data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MGETEKRIETHRIRCLSKLKMFLLAITCAFVSKTLSGSYMNSMLTQIERQFNIPTSLVGF
INGSFEIGNLLLIIFVSYFGTKLHRPIMIGIGCVVMGLGCFLKSLPHFLMNQYEYESTVS
VSGNLSSNSFLCMENGTQILRPTQDPSECTKEVKSLMWVYVLVGNIVRGMGETPILPLGI
SYIEDFAKFENSPLYIGLVETGAIIGPLIGLLLASFCANVYVDTGFVNTDDLIITPTDTR
WVGAWWFGFLICAGVNVLTAIPFFFLPNTLPKEGLETNADIIKNENEDKQKEEVKKEKYG
ITKDFLPFMKSLSCNPIYMLFILVSVIQFNAFVNMISFMPKYLEQQYGISSSDAIFLMGI
YNLPPICIGYIIGGLIMKKFKITVKQAAHIGCWLSLLEYLLYFLSFLMTCENSSVVGINT
SYEGIPQDLYVENDIFADCNVDCNCPSKIWDPVCGNNGLSYLSACLAGCETSIGTGINMV
FQNCSCIQTSGNSSAVLGLCDKGPDCSLMLQYFLILSAMSSFIYSLAAIPGYMVLLRCMK
SEEKSLGVGLHTFCTRVFAGIPAPIYFGALMDSTCLHWGTLKCGESGACRIYDSTTFRYI
YLGLPAALRGSSFVPALIILILLRKCHLPGENASSGTELIETKVKGKENECKDIYQKSTV
LKDDELKTKL
Function
Mediates the Na(+)-independent transport of organic anions such as sulfobromophthalein (BSP) and conjugated (taurocholate) and unconjugated (cholate) bile acids. Selectively inhibited by the grapefruit juice component naringin.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Polyethylene glycol 400 Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Coating agent; Diluent; Ointment base; Plasticizing agent; Solvent; Suppository base; lubricant
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 0.14 %(w/v) (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO1A2_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 0.05 %(w/v) (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO1A2_HUMAN
          DIG Name: Polyoxyl 35 castor oil Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Solubilizing agent; Surfactant
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 0.00054 %(w/v) (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO1A2_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 0.00034 %(w/v) (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO1A2_HUMAN
          DIG Name: Hydroxyethyl-beta-cyclodextrin Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Other agent
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 0.027 %(w/v) (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO1A2_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 0.025 %(w/v) (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO1A2_HUMAN
          DIG Name: Polyoxyl 15 hydroxystearate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Solubilizing agent; Surfactant
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 0.0074 %(w/v) (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO1A2_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 0.0041 %(w/v) (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO1A2_HUMAN
References
1 Pharmaceutical excipients influence the function of human uptake transporting proteins. Mol Pharm. 2012 Sep 4;9(9):2577-81.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.