Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET0U2VJ) | |||||
---|---|---|---|---|---|
Name |
Glutamate receptor AMPA 2 (GRIA2)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
AMPA-selective glutamate receptor 2; AMPAselective glutamate receptor 2; GluA2; GluR-2; GluR-B; GluR-K2; GluR2; GluRB; GluRK2; Glutamate receptor 2; Glutamate receptor ionotropic, AMPA 2
|
||||
Family | Transmembrane channel/porin (TC/P) >> Glutamate-gated ion channel (GIC) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | GRIA2 | Gene ID | |||
UniProt ID | GRIA2_HUMAN | (click to find more protein-related data of this DBT) | |||
TTD ID | T42392 | (click to find more therapeutic target data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MQKIMHISVLLSPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTP
HIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDG THPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINV GNINNDKKDEMYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANL GFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTTTIKYTSALT YDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNI KFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTT ILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKI WNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLD PLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWF SLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDL SKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGK YAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRNAVNLAVLKLNEQGLL DKLKNKWWYDKGECGSGGGDSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSR AEAKRMKVAKNAQNINPSSSQNSQNFATYKEGYNVYGIESVKI |
||||
Function |
L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist.
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Glutamic acid hydrochloride | Click to Show/Hide | |||||
Detailed Information | DIG Info click to show the detail info of this DIG | |||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Acidulant
|
|||||
Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Ki = 940 nM (estimated based on the structural similarity with CHEMBL575060 ) | [1] | ||||
Structural Similarity | Tanimoto coefficient = 1 | |||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | GRIA2_HUMAN | |||||
Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Ki = 280 nM (estimated based on the structural similarity with CHEMBL575060 ) | [2] | ||||
Structural Similarity | Tanimoto coefficient = 1 | |||||
Tested Species | Rattus norvegicus (Rat) | |||||
UniProt ID | GRIA2_RAT | |||||
DIG Name: Monosodium glutamate | Click to Show/Hide | |||||
Detailed Information | DIG Info click to show the detail info of this DIG | |||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Buffering agent; Flavoring agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | EC50 = 2190 nM (estimated based on the structural similarity with CHEMBL575060 ) | [3] | ||||
Structural Similarity | Tanimoto coefficient = 0.979166667 | |||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | GRIA2_HUMAN | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.