Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET0WE5D)
Name
Carbonic anhydrase XII (CA12)
Synonyms    Click to Show/Hide the Synonyms of This DBT
Carbonate dehydratase XII; CA-XII; Tumor antigen HOM-RCC-3.1.3; ; Carbonic anhydrase 12
Family Lyase/isomerase/ligase (L/I/G)  >>  Carbon-oxygen lyase (EC 4.2)
Organism
Homo sapiens (Human)
Gene Name CA12 Gene ID
771
UniProt ID CAH12_HUMAN (click to find more protein-related data of this DBT)
TTD ID T16987 (click to find more therapeutic target data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDL
HSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHL
HWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFN
PSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFR
NPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGL
SLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA
Function
Reversible hydration of carbon dioxide.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Benzosulfimide Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Flavoring agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 633 nM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CAH12_HUMAN
          DIG Name: methylparaben Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 820 nM (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CAH12_HUMAN
          DIG Name: Saccharin sodium dihydrate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Flavoring agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 633 nM (estimated based on the structural similarity with CHEMBL310671 ) [1]
                   Structural Similarity Tanimoto coefficient = 0.962264151
                   Tested Species Homo sapiens (Human)
                   UniProt ID CAH12_HUMAN
          DIG Name: Ethylparaben Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 8600 nM (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CAH12_HUMAN
          DIG Name: Gentisic acid Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antioxidant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 7300 nM (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CAH12_HUMAN
          DIG Name: Hydroquinone Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antioxidant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 7800 nM (tested by experiment) [3]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CAH12_HUMAN
          DIG Name: Phenol Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 9200 nM (tested by experiment) [4]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CAH12_HUMAN
          DIG Name: Sodium cyclamate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Flavoring agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 3.8 nM (tested by experiment) [5]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CAH12_HUMAN
References
1 Carbonic anhydrase inhibitors: copper(II) complexes of polyamino-polycarboxylamido aromatic/heterocyclic sulfonamides are very potent inhibitors of the tumor-associated isoforms IX and XII. Bioorg Med Chem Lett. 2008 Jan 15; 18(2):836-41.
2 Mono-/dihydroxybenzoic acid esters and phenol pyridinium derivatives as inhibitors of the mammalian carbonic anhydrase isoforms I, II, VII, IX, XII and XIV. Bioorg Med Chem. 2013 Mar 15; 21(6):1564-9.
3 Carbonic anhydrase inhibitors: inhibition of mammalian isoforms I-XIV with a series of substituted phenols including paracetamol and salicylic acid. Bioorg Med Chem. 2008 Aug 1; 16(15):7424-8.
4 Kinetic and docking studies of phenol-based inhibitors of carbonic anhydrase isoforms I, II, IX and XII evidence a new binding mode within the enzyme active site. Bioorg Med Chem. 2011 Feb 15; 19(4):1381-9.
5 Sulfamide derivatives with selective carbonic anhydrase VII inhibitory action. Bioorg Med Chem. 2016 Feb 15; 24(4):894-901.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.