Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET01BHO)
Name
Phosphodiesterase 4D (PDE4D)
Synonyms    Click to Show/Hide the Synonyms of This DBT
AMP-specific 3',5'-cyclic phosphodiesterase 4D; DPDE3; PDE43; cAMP-specific 3',5'-cyclic phosphodiesterase 4D
Family Hydrolase (HDase)  >>  Ester bond hydrolase (EC 3.1)
Organism
Homo sapiens (Human)
Gene Name PDE4D Gene ID
5144
UniProt ID PDE4D_HUMAN (click to find more protein-related data of this DBT)
TTD ID T02001 (click to find more therapeutic target data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MEAEGSSAPARAGSGEGSDSAGGATLKAPKHLWRHEQHHQYPLRQPQFRLLHPHHHLPPP
PPPSPQPQPQCPLQPPPPPPLPPPPPPPGAARGRYASSGATGRVRHRGYSDTERYLYCRA
MDRTSYAVETGHRPGLKKSRMSWPSSFQGLRRFDVDNGTSAGRSPLDPMTSPGSGLILQA
NFVHSQRRESFLYRSDSDYDLSPKSMSRNSSIASDIHGDDLIVTPFAQVLASLRTVRNNF
AALTNLQDRAPSKRSPMCNQPSINKATITEEAYQKLASETLEELDWCLDQLETLQTRHSV
SEMASNKFKRMLNRELTHLSEMSRSGNQVSEFISNTFLDKQHEVEIPSPTQKEKEKKKRP
MSQISGVKKLMHSSSLTNSSIPRFGVKTEQEDVLAKELEDVNKWGLHVFRIAELSGNRPL
TVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLST
PALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGF
KLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVL
LLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMC
DKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIPQSPSPAP
DDPEEGRQGQTEKFQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPL
DEQVEEEAVGEEEESQPEACVIDDRSPDT
Function
Hydrolyzes the second messenger cAMP, which is a key regulator of many important physiological processes.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Cetylpyridinium chloride Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative; Penetration agent; Solubilizing agent; Surfactant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 13 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID PDE4D_HUMAN
          DIG Name: D&C red no. 28 Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Colorant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 0.9 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID PDE4D_HUMAN
          DIG Name: Diethyl phthalate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Plasticizing agent; Solvent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 8.5 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID PDE4D_HUMAN
          DIG Name: FD&C blue no. 1 Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Colorant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 28 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID PDE4D_HUMAN
          DIG Name: Palmitic acid Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Penetration agent; lubricant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 6.6 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID PDE4D_HUMAN
          DIG Name: Propyl gallate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative; Antioxidant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 26 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID PDE4D_HUMAN
          DIG Name: Sodium lauryl sulfate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Modified-release agent; Penetration agent; Solubilizing agent; Surfactant; lubricant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 23 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID PDE4D_HUMAN
          DIG Name: Stearic acid Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Solubilizing agent; Viscosity-controlling agent; lubricant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 6.7 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID PDE4D_HUMAN
          DIG Name: Benzethonium chloride Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative; Surfactant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 14 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID PDE4D_HUMAN
          DIG Name: Ethyl vanillate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Flavoring agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 67 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID PDE4D_HUMAN
          DIG Name: Phenylmercuric acetate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 7 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID PDE4D_HUMAN
          DIG Name: FD&C red no. 3 Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Colorant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 0.32 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID PDE4D_HUMAN
          DIG Name: Polysorbate 80 Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Dispersing agent; Emollient; Emulsifying agent; Plasticizing agent; Solubilizing agent; Surfactant; Suspending agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 > 10 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID PDE4D_HUMAN
References
1 The activities of drug inactive ingredients on biological targets. Science. 2020 Jul 24;369(6502):403-413.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.