Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET0XJ4G)
Name
Carbonic anhydrase I (CA1)
Synonyms    Click to Show/Hide the Synonyms of This DBT
Carbonate dehydratase I; Carbonic anhydrase B; CAB; Carbonic anhydrase I; CA-I; Carbonic anhydrase 1; CAB
Family Lyase/isomerase/ligase (L/I/G)  >>  Carbon-oxygen lyase (EC 4.2)
Organism
Homo sapiens (Human)
Gene Name CA1 Gene ID
759
UniProt ID CAH1_HUMAN (click to find more protein-related data of this DBT)
TTD ID T13201 (click to find more therapeutic target data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEI
INVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELH
VAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNF
DPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAV
PMQHNNRPTQPLKGRTVRASF
Function
Can hydrates cyanamide to urea. Reversible hydration of carbon dioxide.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Aminobenzoate sodium Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Lubricant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 8400 nM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CAH1_HUMAN
          DIG Name: Benzosulfimide Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Flavoring agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki > 10000 nM (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CAH1_HUMAN
          DIG Name: Butylated hydroxytoluene Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antioxidant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 245200 nM (tested by experiment) [3]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CAH1_HUMAN
          DIG Name: methylparaben Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 2600 nM (tested by experiment) [4]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CAH1_HUMAN
          DIG Name: Saccharin sodium anhydrous Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Flavoring agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 18540 nM (estimated based on the structural similarity with CHEMBL310671 ) [5]
                   Structural Similarity Tanimoto coefficient = 0.970873786
                   Tested Species Homo sapiens (Human)
                   UniProt ID CAH1_HUMAN
          DIG Name: Tannic acid Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antioxidant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 75900 nM (tested by experiment) [6]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CAH1_HUMAN
          DIG Name: Ammonium sulfate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Buffering agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 35000 nM (estimated based on the structural similarity with CHEMBL355001 ) [7]
                   Structural Similarity Tanimoto coefficient = 0.769230769
                   Tested Species Homo sapiens (Human)
                   UniProt ID CAH1_HUMAN
          DIG Name: Ethylparaben Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 7900 nM (tested by experiment) [4]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CAH1_HUMAN
          DIG Name: Gentisic acid Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antioxidant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 4200 nM (tested by experiment) [4]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CAH1_HUMAN
          DIG Name: Hydroquinone Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antioxidant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 10700 nM (tested by experiment) [8]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CAH1_HUMAN
          DIG Name: Phenol Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 10100 nM (tested by experiment) [9]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CAH1_HUMAN
          DIG Name: Sodium acetate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative; Buffering agent; Flavoring agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 10800 nM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CAH1_HUMAN
          DIG Name: Sodium cyclamate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Flavoring agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki > 10000 nM (tested by experiment) [10]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CAH1_HUMAN
          DIG Name: Sodium iodide Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 300000 nM (tested by experiment) [11]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CAH1_HUMAN
References
1 Carbonic anhydrase inhibitors. Inhibition of the -class enzymes from the fungal pathogens Candida albicans and Cryptococcus neoformans with branched aliphatic/aromatic carboxylates and their derivatives. Bioorg Med Chem Lett. 2011 Apr 15; 21(8):2521-6.
2 A Sweet Combination: Developing Saccharin and Acesulfame K Structures for Selectively Targeting the Tumor-Associated Carbonic Anhydrases IX and XII. J Med Chem. 2020 Jan 9; 63(1):321-333.
3 Carbonic anhydrase inhibitors. Inhibition of human erythrocyte isozymes I and II with a series of antioxidant phenols. Bioorg Med Chem. 2009 Apr 15; 17(8):3207-11.
4 Mono-/dihydroxybenzoic acid esters and phenol pyridinium derivatives as inhibitors of the mammalian carbonic anhydrase isoforms I, II, VII, IX, XII and XIV. Bioorg Med Chem. 2013 Mar 15; 21(6):1564-9.
5 Carbonic anhydrase inhibitors. Inhibition studies of a coral secretory isoform by sulfonamides. Bioorg Med Chem. 2009 Jul 15; 17(14):5054-8.
6 In vitro inhibition of -carbonic anhydrase isozymes by some phenolic compounds. Bioorg Med Chem Lett. 2011 Jul 15; 21(14):4259-62.
7 Carbonic anhydrase inhibitors: inhibition of cytosolic isozymes I and II with sulfamide derivatives. Bioorg Med Chem Lett. 2003 Mar 10; 13(5):837-40.
8 Carbonic anhydrase inhibitors: Inhibition of the new membrane-associated isoform XV with phenols. Bioorg Med Chem Lett. 2008 Jun 15; 18(12):3593-6.
9 Natural product-based phenols as novel probes for mycobacterial and fungal carbonic anhydrases. J Med Chem. 2011 Mar 24; 54(6):1682-92.
10 Sulfamide derivatives with selective carbonic anhydrase VII inhibitory action. Bioorg Med Chem. 2016 Feb 15; 24(4):894-901.
11 Anion inhibition studies of the fastest carbonic anhydrase (CA) known, the extremo-CA from the bacterium Sulfurihydrogenibium azorense. Bioorg Med Chem Lett. 2012 Dec 1; 22(23):7142-5.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.