Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET0I1AX)
Name
Solute carrier SLCO2B1 (OATPB)
Synonyms    Click to Show/Hide the Synonyms of This DBT
Solute carrier family 21 member 9; Solute carrier organic anion transporter family member 2B1; Organic anion transporter B;KIAA0880; OATP-B; OATP-RP2; OATP2B1; OATPB; OATPRP2; Organic anion transporter polypeptide-related protein 2; SLC21A9
Family Potential-driven transporter (PDT)  >>  Organo anion transporter (OAT)
Organism
Homo sapiens (Human)
Gene Name SLCO2B1 Gene ID
11309
UniProt ID SO2B1_HUMAN (click to find more protein-related data of this DBT)
TTD ID T34064 (click to find more therapeutic target data of this DBT)
VARIDT ID DTD0031 (click to find more drug transporter data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MGPRIGPAGEVPQVPDKETKATMGTENTPGGKASPDPQDVRPSVFHNIKLFVLCHSLLQL
AQLMISGYLKSSISTVEKRFGLSSQTSGLLASFNEVGNTALIVFVSYFGSRVHRPRMIGY
GAILVALAGLLMTLPHFISEPYRYDNTSPEDMPQDFKASLCLPTTSAPASAPSNGNCSSY
TETQHLSVVGIMFVAQTLLGVGGVPIQPFGISYIDDFAHNSNSPLYLGILFAVTMMGPGL
AFGLGSLMLRLYVDINQMPEGGISLTIKDPRWVGAWWLGFLIAAGAVALAAIPYFFFPKE
MPKEKRELQFRRKVLAVTDSPARKGKDSPSKQSPGESTKKQDGLVQIAPNLTVIQFIKVF
PRVLLQTLRHPIFLLVVLSQVCLSSMAAGMAIFLPKFLERQFSITASYANLLIGCLSFPS
VIVGIVVGGVLVKRLHLGPVGCGALCLLGMLLCLFFSLPLFFIGCSSHQIAGITHQTSAH
PGLELSPSCMEACSCPLDGFNPVCDPSTRVEYITPCHAGCSSWVVQDALDNSQVFYTNCS
CVVEGNPVLAGSCDSTCSHLVVPFLLLVSLGSALACLTHTPSFMLILRGVKKEDKTLAVG
IQFMFLRILAWMPSPVIHGSAIDTTCVHWALSCGRRAVCRYYNNDLLRNRFIGLQFFFKT
GSVICFALVLAVLRQQDKEARTKESRSSPAVEQQLLVSGPGKKPEDSRV
Function
Mediates the Na(+)-independent transport of organic anions such as taurocholate, the prostaglandins PGD2, PGE1, PGE2, leukotriene C4, thromboxane B2 and iloprost.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Allura red AC dye Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Colorant
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio = 96.52 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 2.59 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (3) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 4.7 uM (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: Butylparaben Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio = 73.5 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 44.3 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: Cetylpyridinium chloride Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative; Penetration agent; Solubilizing agent; Surfactant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio = 47.5 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: D&C brown no. 1 Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Colorant
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio = 86.9 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 3.11 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (3) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 2.8 uM (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: D&C green no. 5 Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Colorant
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio = 89 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 1.54 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: D&C red no. 27 Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Colorant
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio = 69 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 1 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: D&C red no. 28 Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Colorant
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio = 77 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 1 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (3) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 0.6 uM (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: D&C red no. 33 Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Colorant
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio = 60.9 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 58.1 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: Docusate sodium Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Surfactant
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio = 87.8 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 2.76 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (3) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 2.3 uM (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: Ethyl acetate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Flavoring agent; Solvent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Promotion ratio = 43 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: FD&C blue no. 1 Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Colorant
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio = 80.5 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 13 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: FD&C blue no. 2 Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Colorant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio = 26 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: FD&C red no. 4 Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Colorant
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio = 91.26 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 8.1 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: Monoammonium glycyrrhizate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Flavoring agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio = 41.4 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: Propyl 4-hydroxybenzoate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio = 25.1 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 200 uM (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: Propyl gallate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative; Antioxidant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio = 29.6 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: Silotermo carmine G Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Colorant
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio = 60.3 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 11.3 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (3) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 10 uM (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: Sodium lauryl sulfate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Modified-release agent; Penetration agent; Solubilizing agent; Surfactant; lubricant
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio = 88.6 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 1.98 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (3) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 2.8 uM (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: Sunset yellow FCF Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Colorant
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio = 54.5 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 68.4 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (3) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 74 uM (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: Benzalkonium chloride Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative; Penetration agent; Solubilizing agent; Surfactant
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio = 77.4 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 62.1 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: Ethylparaben Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio = 25.4 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: Light green CF yellowish Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Colorant
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio = 86.2 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 0.8 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: Naphthol blue black Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Colorant
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio = 89.1 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 0.4 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (3) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 0.4 uM (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: Naphthol yellow S Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Colorant
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio = 72.5 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 24.5 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: Neohesperidin dihydrochalcone Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Flavoring agent
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio = 85.3 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio = 32.9 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (3) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 20.1 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: Calcium pyrophosphate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Acidulant; Diluent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Promotion ratio = 37 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: FD&C red no. 3 Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Colorant
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio = 75.9 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 0.88 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: Polyoxyl 35 castor oil Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Solubilizing agent; Surfactant
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 0.0011 %(w/v) (tested by experiment) [3]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 0.0098 %(w/v) (tested by experiment) [3]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: Guinea green B Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Colorant
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio = 88.9 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 0.77 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (3) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 0.7 uM (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: Light green SF yellowish Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Colorant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 0.7 M (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: Ponceau 2R Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Colorant
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio = 88.5 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 3.45 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (3) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 3.1 uM (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: Rhodamine B Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Colorant
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio = 73.3 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 44.4 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: Sodium 1,2-ethanedisulfonate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Other agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Promotion ratio = 36 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: Sodium sulfite Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative; Antioxidant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Promotion ratio = 31 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: Carmine Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Colorant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio = 29.4 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: D&C orange no. 4 Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Colorant
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio = 86.6 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 2.11 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (3) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 1.9 uM (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: DL-aspartic acid potassium salt Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Other agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Promotion ratio = 36 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: Hydroxyethyl-beta-cyclodextrin Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Other agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 0.01 %(w/v) (tested by experiment) [3]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: Pigment yellow 62 Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Colorant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio = 44.9 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: Polyoxyl 15 hydroxystearate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Solubilizing agent; Surfactant
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 0.011 %(w/v) (tested by experiment) [3]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 0.00095 %(w/v) (tested by experiment) [3]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: Sucrose monolaurate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Surfactant
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio = 78.5 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Ki = 47.7 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
          DIG Name: Yellow AB Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Colorant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio = 37 % (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID SO2B1_HUMAN
References
1 Bacterial metabolism rescues the inhibition of intestinal drug absorption by food and drug additives. Proc Natl Acad Sci U S A. 2020 Jul 7;117(27):16009-16018.
2 The activities of drug inactive ingredients on biological targets. Science. 2020 Jul 24;369(6502):403-413.
3 Pharmaceutical excipients influence the function of human uptake transporting proteins. Mol Pharm. 2012 Sep 4;9(9):2577-81.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.