Details of the Biological Target of DIG (DBT)
General Information of DBT (ID: ET0SO0T) | |||||
---|---|---|---|---|---|
Name |
Multidrug resistance protein 1 (ABCB1)
|
||||
Synonyms |
Click to Show/Hide the Synonyms of This DBT
ATP-binding cassette sub-family B member 1; CD243; CD243 antigen; MDR1; Multidrug resistance protein 1; P-glycoprotein 1; PGY1; Phospholipid transporter ABCB1
|
||||
Family | Primary active transporter (PAT) >> ATP-binding cassette transporter (ABC) | ||||
Organism |
Homo sapiens (Human)
|
||||
Gene Name | ABCB1 | Gene ID | |||
UniProt ID | MDR1_HUMAN | (click to find more protein-related data of this DBT) | |||
TTD ID | T25258 | (click to find more therapeutic target data of this DBT) | |||
VARIDT ID | DTD0003 | (click to find more drug transporter data of this DBT) | |||
Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
Sequence |
MDLEGDRNGGAKKKNFFKLNNKSEKDKKEKKPTVSVFSMFRYSNWLDKLYMVVGTLAAII
HGAGLPLMMLVFGEMTDIFANAGNLEDLMSNITNRSDINDTGFFMNLEEDMTRYAYYYSG IGAGVLVAAYIQVSFWCLAAGRQIHKIRKQFFHAIMRQEIGWFDVHDVGELNTRLTDDVS KINEGIGDKIGMFFQSMATFFTGFIVGFTRGWKLTLVILAISPVLGLSAAVWAKILSSFT DKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANISIG AAFLLIYASYALAFWYGTTLVLSGEYSIGQVLTVFFSVLIGAFSVGQASPSIEAFANARG AAYEIFKIIDNKPSIDSYSKSGHKPDNIKGNLEFRNVHFSYPSRKEVKILKGLNLKVQSG QTVALVGNSGCGKSTTVQLMQRLYDPTEGMVSVDGQDIRTINVRFLREIIGVVSQEPVLF ATTIAENIRYGRENVTMDEIEKAVKEANAYDFIMKLPHKFDTLVGERGAQLSGGQKQRIA IARALVRNPKILLLDEATSALDTESEAVVQVALDKARKGRTTIVIAHRLSTVRNADVIAG FDDGVIVEKGNHDELMKEKGIYFKLVTMQTAGNEVELENAADESKSEIDALEMSSNDSRS SLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWPYFVVGVFCAII NGGLQPAFAIIFSKIIGVFTRIDDPETKRQNSNLFSLLFLALGIISFITFFLQGFTFGKA GEILTKRLRYMVFRSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGAIGSRLAVITQNI ANLGTGIIISFIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEA IENFRTVVSLTQEQKFEHMYAQSLQVPYRNSLRKAHIFGITFSFTQAMMYFSYAGCFRFG AYLVAHKLMSFEDVLLVFSAVVFGAMAVGQVSSFAPDYAKAKISAAHIIMIIEKTPLIDS YSTEGLMPNTLEGNVTFGEVVFNYPTRPDIPVLQGLSLEVKKGQTLALVGSSGCGKSTVV QLLERFYDPLAGKVLLDGKEIKRLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSRVV SQEEIVRAAKEANIHAFIESLPNKYSTKVGDKGTQLSGGQKQRIAIARALVRQPHILLLD EATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQL LAQKGIYFSMVSVQAGTKRQ |
||||
Function |
Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells.
|
||||
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
---|---|---|---|---|---|---|
DIG Name: Glyceryl monooleate | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Bioadhesive material; Emollient; Emulsifying agent; Emulsion stabilizing agent; Gelling agent; Modified-release agent; Surfactant
|
|||||
Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Protein expression downregulation = 39.1 % (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN ; MDR3_HUMAN ; ABCB5_HUMAN | |||||
Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Inhibition ratio = 39 % (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN ; MDR3_HUMAN ; ABCB5_HUMAN | |||||
Experiment (3) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Inhibition ratio = 63 % (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN ; MDR3_HUMAN ; ABCB5_HUMAN | |||||
DIG Name: Glyceryl monostearate | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Emollient; Emulsifying agent; Emulsion stabilizing agent; Solubilizing agent; Surfactant; Viscosity-controlling agent
|
|||||
Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Protein expression downregulation = 52.3 % (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN ; MDR3_HUMAN ; ABCB5_HUMAN | |||||
Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Inhibition ratio = 46 % (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN ; MDR3_HUMAN ; ABCB5_HUMAN | |||||
Experiment (3) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Inhibition ratio = 47 % (tested by experiment) | [1] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN ; MDR3_HUMAN ; ABCB5_HUMAN | |||||
DIG Name: Polyethylene glycol 2000 | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Coating agent; Diluent; Ointment base; Plasticizing agent; Solvent; Suppository base; lubricant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Inhibition ratio = 40 % (tested by experiment) | [2] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN ; MDR3_HUMAN ; ABCB5_HUMAN | |||||
DIG Name: Polyethylene glycol 20000 | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Coating agent; Diluent; Ointment base; Plasticizing agent; Solvent; Suppository base; lubricant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Inhibition ratio = 72 % (tested by experiment) | [2] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN ; MDR3_HUMAN ; ABCB5_HUMAN | |||||
DIG Name: Polyethylene glycol 300 | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Coating agent; Diluent; Ointment base; Plasticizing agent; Solvent; Suppository base; lubricant
|
|||||
Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Inhibition ratio = 54 % (tested by experiment) | [3] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN ; MDR3_HUMAN ; ABCB5_HUMAN | |||||
Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Inhibition ratio = 90 % (tested by experiment) | [4] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN ; MDR3_HUMAN ; ABCB5_HUMAN | |||||
Experiment (3) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Inhibition ratio = 94 % (tested by experiment) | [4] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN ; MDR3_HUMAN ; ABCB5_HUMAN | |||||
DIG Name: Polyethylene glycol 3350 | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Coating agent; Diluent; Ointment base; Plasticizing agent; Solvent; Suppository base; lubricant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Protein expression downregulation (tested by experiment) | [5] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN | |||||
DIG Name: Polyethylene glycol 400 | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Coating agent; Diluent; Ointment base; Plasticizing agent; Solvent; Suppository base; lubricant
|
|||||
Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Inhibition ratio = 28 % (tested by experiment) | [3] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN ; MDR3_HUMAN ; ABCB5_HUMAN | |||||
Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Inhibition ratio = 64 % (tested by experiment) | [2] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN ; MDR3_HUMAN ; ABCB5_HUMAN | |||||
DIG Name: Polyoxyl 35 castor oil | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Solubilizing agent; Surfactant
|
|||||
Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 5 mg.mL-1 (tested by experiment) | [6] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN ; MDR3_HUMAN ; ABCB5_HUMAN | |||||
Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Inhibition ratio = 61 % (tested by experiment) | [4] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN ; MDR3_HUMAN ; ABCB5_HUMAN | |||||
Experiment (3) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Inhibition ratio > 100 % (tested by experiment) | [7] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN ; MDR3_HUMAN ; ABCB5_HUMAN | |||||
DIG Name: Polyoxyl 40 stearate | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Surfactant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Inhibition ratio = 72.1 % (tested by experiment) | [8] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN ; MDR3_HUMAN ; ABCB5_HUMAN | |||||
DIG Name: Polysorbate 20 | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Dispersing agent; Emollient; Emulsifying agent; Plasticizing agent; Solubilizing agent; Surfactant; Suspending agent
|
|||||
Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 0.25 mg.mL-1 (tested by experiment) | [6] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN ; MDR3_HUMAN ; ABCB5_HUMAN | |||||
Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Inhibition ratio > 240 % (tested by experiment) | [7] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN ; MDR3_HUMAN ; ABCB5_HUMAN | |||||
DIG Name: Polysorbate 80 | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Dispersing agent; Emollient; Emulsifying agent; Plasticizing agent; Solubilizing agent; Surfactant; Suspending agent
|
|||||
Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | IC50 = 0.31 mg.mL-1 (tested by experiment) | [6] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN ; MDR3_HUMAN ; ABCB5_HUMAN | |||||
Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Inhibition ratio = 60 % (tested by experiment) | [4] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN ; MDR3_HUMAN ; ABCB5_HUMAN | |||||
Experiment (3) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Inhibition ratio > 250 % (tested by experiment) | [7] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN ; MDR3_HUMAN ; ABCB5_HUMAN | |||||
DIG Name: Propylene glycol monostearate | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Emollient; Emulsifying agent; Surfactant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Inhibition ratio = 25 % (tested by experiment) | [2] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN ; MDR3_HUMAN ; ABCB5_HUMAN | |||||
DIG Name: Sorbitan monolaurate | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Dispersing agent; Emulsifying agent; Solubilizing agent; Surfactant; Suspending agent; Vaccine adjuvant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Inhibition ratio > 70 % (tested by experiment) | [7] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN ; MDR3_HUMAN ; ABCB5_HUMAN | |||||
DIG Name: Tocophersolan | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Antioxidant; Binding agent; Emulsifying agent; Ointment base; Solubilizing agent; Surfactant; Suspending agent
|
|||||
Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Inhibition ratio = 50 % (tested by experiment) | [9] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN ; MDR3_HUMAN ; ABCB5_HUMAN | |||||
Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Inhibition ratio > 200 % (tested by experiment) | [7] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN ; MDR3_HUMAN ; ABCB5_HUMAN | |||||
DIG Name: Laureth-23 | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Dispersing agent; Emulsifying agent; Gelling agent; Penetration agent; Solubilizing agent; Surfactant; Viscosity-controlling agent
|
|||||
Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Inhibition ratio = 72 % (tested by experiment) | [10] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN ; MDR3_HUMAN ; ABCB5_HUMAN | |||||
Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Inhibition ratio = 81.7 % (tested by experiment) | [10] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN ; MDR3_HUMAN ; ABCB5_HUMAN | |||||
Experiment (3) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Inhibition ratio = 89.7 % (tested by experiment) | [10] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN ; MDR3_HUMAN ; ABCB5_HUMAN | |||||
DIG Name: Laureth-4 | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Dispersing agent; Emulsifying agent; Gelling agent; Penetration agent; Solubilizing agent; Surfactant; Viscosity-controlling agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Inhibition ratio > 230 % (tested by experiment) | [7] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN ; MDR3_HUMAN ; ABCB5_HUMAN | |||||
DIG Name: Propylene glycol monolaurate | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Emollient; Emulsifying agent; Oleaginous vehicle; Penetration agent; Solubilizing agent; Surfactant
|
|||||
Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Inhibition ratio = 55 % (tested by experiment) | [2] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN ; MDR3_HUMAN ; ABCB5_HUMAN | |||||
Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Inhibition ratio = 45 % (tested by experiment) | [2] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN ; MDR3_HUMAN ; ABCB5_HUMAN | |||||
DIG Name: Cremophor RH | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Other agent
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Inhibition ratio > 70 % (tested by experiment) | [7] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN ; MDR3_HUMAN ; ABCB5_HUMAN | |||||
DIG Name: Pluronic F123 | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Solubilizing agent; Surfactant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Inhibition ratio = 85 % (tested by experiment) | [11] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN ; MDR3_HUMAN ; ABCB5_HUMAN | |||||
DIG Name: Pluronic P85 | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Solubilizing agent; Surfactant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Inhibition ratio > 150 % (tested by experiment) | [7] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN ; MDR3_HUMAN ; ABCB5_HUMAN | |||||
DIG Name: Pregelatinized starch | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Binding agent; Diluent; Disintegrant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Protein expression downregulation (tested by experiment) | [5] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN | |||||
DIG Name: Propylene glycol monooleate | Click to Show/Hide | |||||
Detailed Information |
DIG Info
![]() |
|||||
Functional Class | Click to Show/Hide the Functional Class of This DIG
Emollient; Emulsifying agent; Surfactant
|
|||||
Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
Biological Activity | Inhibition ratio = 45 % (tested by experiment) | [2] | ||||
Tested Species | Homo sapiens (Human) | |||||
UniProt ID | MDR1_HUMAN ; MDR3_HUMAN ; ABCB5_HUMAN | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.