Details of the Biological Target of DIG (DBT)
| General Information of DBT (ID: ET0LD0L) | |||||
|---|---|---|---|---|---|
| Name |
Albendazole monooxygenase (CYP3A4)
|
||||
| Synonyms |
Click to Show/Hide the Synonyms of This DBT
Albendazole monooxygenase (sulfoxide-forming); Albendazole sulfoxidase; CYP3A3; CYPIIIA3; CYPIIIA4; Cholesterol 25-hydroxylase; Cytochrome P450 3A3; Cytochrome P450 3A4; Cytochrome P450 HLp; Cytochrome P450 NF-25; Cytochrome P450-PCN1; HLp; 1,4-cineole 2-exo-monooxygenase; 1,8-cineole 2-exo-monooxygenase; NF-25; Nifedipine oxidase; P450-PCN1; Quinine 3-monooxygenase; Taurochenodeoxycholate 6-alpha-hydroxylase
|
||||
| Family | Oxidoreductase (ORase) >> Oxygen paired donor oxidoreductase (EC 1.14) | ||||
| Organism |
Homo sapiens (Human)
|
||||
| Gene Name | CYP3A4 | Gene ID | |||
| UniProt ID | CP3A4_HUMAN | (click to find more protein-related data of this DBT) | |||
| TTD ID | T37848 | (click to find more therapeutic target data of this DBT) | |||
| INTEDE ID | DME0001 | (click to find more drug-metabolizing enzyme data of this DBT) | |||
| Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target | |||||
| Sequence |
MALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMF
DMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISI AEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYS MDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICV FPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSI IFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVV NETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFS KKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLG GLLQPEKPVVLKVESRDGTVSGA |
||||
| Function |
In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It performs a variety of oxidation reactions (e. g. caffeine 8-oxidation, omeprazole sulphoxidation, midazolam 1'-hydroxylation and midazolam 4-hydroxylation) of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. Acts as a 1,8-cineole 2-exo-monooxygenase. The enzyme also hydroxylates etoposide. Catalyzes 4-beta-hydroxylation of cholesterol.
|
||||
| Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT | ||||||
|---|---|---|---|---|---|---|
| DIG Name: Docusate sodium | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Surfactant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 65 uM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Oleic acid | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Penetration agent; Solubilizing agent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Inhibition ratio < 20 % (tested by experiment) | [2] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Benzethonium chloride | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative; Surfactant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 595.5 uM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Cetrimonium bromide | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative; Surfactant
|
|||||
| Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 197 uM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 196.8 uM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Sodium desoxycholate | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Antioxidant; Surfactant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 13 uM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Sucrose palmitate | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Dispersing agent; Emulsifying agent; Solubilizing agent; Surfactant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | EC50 = 8.8 uM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Ascorbic acid | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Acidulant; Antioxidant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 4.1 mg.mL-1 (tested by experiment) | [2] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Calcium hydrogenphosphate | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Diluent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Protein expression downregulation (tested by experiment) | [3] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Carboxymethylcellulose sodium | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Adsorbent; Binding agent; Disintegrant; Emulsifying agent; Suspending agent; Viscosity-controlling agent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | EC50 = 12.6 uM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Carmellose sodium | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Disintegrant
|
|||||
| Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Protein expression upregulation (tested by experiment) | [3] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Protein expression upregulation (tested by experiment) | [3] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Crospovidone | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Disintegrant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Protein expression downregulation (tested by experiment) | [3] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Hydrogenated polyoxyl 40 castor oil | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Solubilizing agent; Surfactant
|
|||||
| Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 800 uM (tested by experiment) | [4] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 0.25 mg.mL-1 (tested by experiment) | [2] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Hypromellose | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Coating agent
|
|||||
| Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Protein expression upregulation (tested by experiment) | [3] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Protein expression downregulation (tested by experiment) | [3] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Magnesium stearate | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
lubricant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Protein expression downregulation (tested by experiment) | [3] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Poloxamer 188 | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Solubilizing agent; Surfactant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 60 uM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Poloxamer 407 | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Solubilizing agent; Surfactant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | EC50 = 32.8 uM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Polyethylene glycol 1000 | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Coating agent; Diluent; Ointment base; Plasticizing agent; Solvent; Suppository base; lubricant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Inhibition ratio < 60 % (tested by experiment) | [2] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Polyethylene glycol 200 | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Coating agent; Diluent; Ointment base; Plasticizing agent; Solvent; Suppository base; lubricant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Inhibition ratio < 60 % (tested by experiment) | [2] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Polyethylene glycol 2000 | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Coating agent; Diluent; Ointment base; Plasticizing agent; Solvent; Suppository base; lubricant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Inhibition ratio < 90 % (tested by experiment) | [2] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Polyethylene glycol 3350 | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Coating agent; Diluent; Ointment base; Plasticizing agent; Solvent; Suppository base; lubricant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Protein expression upregulation (tested by experiment) | [3] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Polyethylene glycol 400 | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Coating agent; Diluent; Ointment base; Plasticizing agent; Solvent; Suppository base; lubricant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 10.77 mg.mL-1 (tested by experiment) | [2] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Polyethylene glycol 4000 | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Coating agent; Diluent; Ointment base; Plasticizing agent; Solvent; Suppository base; lubricant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Inhibition ratio < 40 % (tested by experiment) | [2] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Polyethylene glycol 6000 | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Coating agent; Diluent; Ointment base; Plasticizing agent; Solvent; Suppository base; lubricant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Inhibition ratio < 70 % (tested by experiment) | [2] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Polyoxyl 35 castor oil | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Solubilizing agent; Surfactant
|
|||||
| Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | EC50 = 306.5 uM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 600 uM (tested by experiment) | [4] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Polyoxyl 40 stearate | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Surfactant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 322.2 uM (tested by experiment) | [5] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Polysorbate 20 | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Dispersing agent; Emollient; Emulsifying agent; Plasticizing agent; Solubilizing agent; Surfactant; Suspending agent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | EC50 = 363.7 uM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Polysorbate 80 | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Dispersing agent; Emollient; Emulsifying agent; Plasticizing agent; Solubilizing agent; Surfactant; Suspending agent
|
|||||
| Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 201 uM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 400 uM (tested by experiment) | [4] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| Experiment (3) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Protein expression downregulation (tested by experiment) | [3] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Povidone | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Binding agent; Coating agent; Disintegrant; Film/membrane-forming agent; Solubilizing agent; Suspending agent
|
|||||
| Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 107 uM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Protein expression upregulation (tested by experiment) | [3] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Propylene glycol | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative; Humectant; Plasticizing agent; Solvent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Inhibition ratio < 20 % (tested by experiment) | [2] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Silicon dioxide | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Anticaking agent; Opacifying agent; Viscosity-controlling agent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Protein expression downregulation (tested by experiment) | [3] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Sodium alginate | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Binding agent; Disintegrant; Suspending agent; Viscosity-controlling agent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Inhibition ratio < 20 % (tested by experiment) | [2] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Soybean lecithin | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Other agent
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 6.61 mg.mL-1 (tested by experiment) | [2] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Tocophersolan | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Antioxidant; Binding agent; Emulsifying agent; Ointment base; Solubilizing agent; Surfactant; Suspending agent
|
|||||
| Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | EC50 = 28.3 uM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 150 uM (tested by experiment) | [4] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Sodium lauryl sulfoacetate | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Complexing agent; Surfactant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 0.29 mg.mL-1 (tested by experiment) | [2] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Sodium sulhydrate | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Inhibition ratio < 90 % (tested by experiment) | [2] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Polyoxyl 15 hydroxystearate | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Solubilizing agent; Surfactant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | EC50 = 88.3 uM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Pregelatinized starch | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Binding agent; Diluent; Disintegrant
|
|||||
| Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Protein expression downregulation (tested by experiment) | [3] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | Protein expression downregulation (tested by experiment) | [3] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Sodium caprylate | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Surfactant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | EC50 = 9.5 uM (tested by experiment) | [1] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
| DIG Name: Sucrose laurate | Click to Show/Hide | |||||
| Detailed Information |
DIG Info
click to show the detail info of this DIG
|
|||||
| Functional Class | Click to Show/Hide the Functional Class of This DIG
Surfactant
|
|||||
| Experiment for Assessing the Biological Activity of This DIG on the Studied DBT | ||||||
| Biological Activity | IC50 = 200 uM (tested by experiment) | [4] | ||||
| Tested Species | Homo sapiens (Human) | |||||
| UniProt ID | CP3A4_HUMAN | |||||
If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.

