Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET0WD0D)
Name
Cytochrome P450 2C9 (CYP2C9)
Synonyms    Click to Show/Hide the Synonyms of This DBT
Cytochrome P-450MP; Cytochrome P450 MP-4; Cytochrome P450 MP-8; (R)-limonene 6-monooxygenase; (S)-limonene 6-monooxygenase; (S)-limonene 7-monooxygenase; CYP2C10; CYPIIC9; Cholesterol 25-hydroxylase; Cytochrome P450 PB-1; S-mephenytoin 4-hydroxylase
Family Oxidoreductase (ORase)  >>  Oxygen paired donor oxidoreductase (EC 1.14)
Organism
Homo sapiens (Human)
Gene Name CYP2C9 Gene ID
1559
UniProt ID CP2C9_HUMAN (click to find more protein-related data of this DBT)
TTD ID T19244 (click to find more therapeutic target data of this DBT)
INTEDE ID DME0019 (click to find more drug-metabolizing enzyme data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MDSLVVLVLCLSCLLLLSLWRQSSGRGKLPPGPTPLPVIGNILQIGIKDISKSLTNLSKV
YGPVFTLYFGLKPIVVLHGYEAVKEALIDLGEEFSGRGIFPLAERANRGFGIVFSNGKKW
KEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICS
IIFHKRFDYKDQQFLNLMEKLNENIKILSSPWIQICNNFSPIIDYFPGTHNKLLKNVAFM
KSYILEKVKEHQESMDMNNPQDFIDCFLMKMEKEKHNQPSEFTIESLENTAVDLFGAGTE
TTSTTLRYALLLLLKHPEVTAKVQEEIERVIGRNRSPCMQDRSHMPYTDAVVHEVQRYID
LLPTSLPHAVTCDIKFRNYLIPKGTTILISLTSVLHDNKEFPNPEMFDPHHFLDEGGNFK
KSKYFMPFSAGKRICVGEALAGMELFLFLTSILQNFNLKSLVDPKNLDTTPVVNGFASVP
PFYQLCFIPV
Function
In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. This enzyme contributes to the wide pharmacokinetics variability of the metabolism of drugs such as S-warfarin, diclofenac, phenytoin, tolbutamide and losartan. Cytochromes P450 are a group of heme-thiolate monooxygenases.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Docusate sodium Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Surfactant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 203.3 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP2C9_HUMAN
          DIG Name: Cetrimonium bromide Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative; Surfactant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 178.5 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP2C9_HUMAN
          DIG Name: Sodium desoxycholate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antioxidant; Surfactant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 118 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP2C9_HUMAN
          DIG Name: Sucrose palmitate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Dispersing agent; Emulsifying agent; Solubilizing agent; Surfactant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 559 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP2C9_HUMAN
          DIG Name: Carboxymethylcellulose sodium Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Adsorbent; Binding agent; Disintegrant; Emulsifying agent; Suspending agent; Viscosity-controlling agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 113.2 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP2C9_HUMAN
          DIG Name: Gelatin Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Other agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 249.5 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP2C9_HUMAN
          DIG Name: Hydrogenated polyoxyl 40 castor oil Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Solubilizing agent; Surfactant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 30 uM (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP2C9_HUMAN
          DIG Name: Poloxamer 188 Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Solubilizing agent; Surfactant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 244.8 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP2C9_HUMAN
          DIG Name: Poloxamer 407 Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Solubilizing agent; Surfactant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 355 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP2C9_HUMAN
          DIG Name: Polyethylene glycol 1000 Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Coating agent; Diluent; Ointment base; Plasticizing agent; Solvent; Suppository base; lubricant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 365.6 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP2C9_HUMAN
          DIG Name: Polyoxyl 35 castor oil Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Solubilizing agent; Surfactant
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 41.1 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP2C9_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 30 uM (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP2C9_HUMAN
          DIG Name: Polyoxyl 40 stearate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Surfactant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 27.4 uM (tested by experiment) [3]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP2C9_HUMAN
          DIG Name: Polysorbate 20 Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Dispersing agent; Emollient; Emulsifying agent; Plasticizing agent; Solubilizing agent; Surfactant; Suspending agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 228.4 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP2C9_HUMAN
          DIG Name: Polysorbate 80 Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Dispersing agent; Emollient; Emulsifying agent; Plasticizing agent; Solubilizing agent; Surfactant; Suspending agent
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 374.2 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP2C9_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 40 uM (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP2C9_HUMAN
          DIG Name: Tocophersolan Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antioxidant; Binding agent; Emulsifying agent; Ointment base; Solubilizing agent; Surfactant; Suspending agent
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 40.1 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP2C9_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 300 uM (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP2C9_HUMAN
          DIG Name: Polyoxyl 20 cetyl ether Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Ointment base; Solubilizing agent; Surfactant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 391.4 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP2C9_HUMAN
          DIG Name: Kollicoat IR Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Film/Membrane-forming agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 259.8 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP2C9_HUMAN
          DIG Name: Polyoxyl 15 hydroxystearate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Solubilizing agent; Surfactant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 123.2 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP2C9_HUMAN
          DIG Name: Sodium caprylate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Surfactant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 213.5 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP2C9_HUMAN
          DIG Name: Sucrose laurate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Surfactant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 70 uM (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP2C9_HUMAN
References
1 Mediation of in vitro cytochrome p450 activity by common pharmaceutical excipients. Mol Pharm. 2013 Jul 1;10(7):2739-48.
2 Effects of non-ionic surfactants on cytochrome P450-mediated metabolism in vitro. Eur J Pharm Biopharm. 2011 May;78(1):166-72.
3 Effects of polyoxyethylene (40) stearate on the activity of P-glycoprotein and cytochrome P450. Eur J Pharm Sci. 2009 Jul 12;37(5):573-80.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.