Details of the Biological Target of DIG (DBT)

General Information of DBT (ID: ET0LD0L)
Name
Albendazole monooxygenase (CYP3A4)
Synonyms    Click to Show/Hide the Synonyms of This DBT
Albendazole monooxygenase (sulfoxide-forming); Albendazole sulfoxidase; CYP3A3; CYPIIIA3; CYPIIIA4; Cholesterol 25-hydroxylase; Cytochrome P450 3A3; Cytochrome P450 3A4; Cytochrome P450 HLp; Cytochrome P450 NF-25; Cytochrome P450-PCN1; HLp; 1,4-cineole 2-exo-monooxygenase; 1,8-cineole 2-exo-monooxygenase; NF-25; Nifedipine oxidase; P450-PCN1; Quinine 3-monooxygenase; Taurochenodeoxycholate 6-alpha-hydroxylase
Family Oxidoreductase (ORase)  >>  Oxygen paired donor oxidoreductase (EC 1.14)
Organism
Homo sapiens (Human)
Gene Name CYP3A4 Gene ID
1576
UniProt ID CP3A4_HUMAN (click to find more protein-related data of this DBT)
TTD ID T37848 (click to find more therapeutic target data of this DBT)
INTEDE ID DME0001 (click to find more drug-metabolizing enzyme data of this DBT)
   Click to Show/Hide the Molecular/Function Data (Sequence/Function) of This Target
Sequence
MALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMF
DMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISI
AEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYS
MDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICV
FPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSI
IFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVV
NETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFS
KKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLG
GLLQPEKPVVLKVESRDGTVSGA
Function
In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It performs a variety of oxidation reactions (e. g. caffeine 8-oxidation, omeprazole sulphoxidation, midazolam 1'-hydroxylation and midazolam 4-hydroxylation) of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. Acts as a 1,8-cineole 2-exo-monooxygenase. The enzyme also hydroxylates etoposide. Catalyzes 4-beta-hydroxylation of cholesterol.
Full List of Drug Inactive Ingredients (DIGs) Regulating This DBT
          DIG Name: Docusate sodium Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Surfactant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 65 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Oleic acid Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Penetration agent; Solubilizing agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio < 20 % (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Benzethonium chloride Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative; Surfactant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 595.5 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Cetrimonium bromide Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative; Surfactant
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 197 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 196.8 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Sodium desoxycholate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antioxidant; Surfactant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 13 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Sucrose palmitate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Dispersing agent; Emulsifying agent; Solubilizing agent; Surfactant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 8.8 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Ascorbic acid Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Acidulant; Antioxidant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 4.1 mg.mL-1 (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Calcium hydrogenphosphate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Diluent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Protein expression downregulation (tested by experiment) [3]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Carboxymethylcellulose sodium Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Adsorbent; Binding agent; Disintegrant; Emulsifying agent; Suspending agent; Viscosity-controlling agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 12.6 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Carmellose sodium Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Disintegrant
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Protein expression upregulation (tested by experiment) [3]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Protein expression upregulation (tested by experiment) [3]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Crospovidone Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Disintegrant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Protein expression downregulation (tested by experiment) [3]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Hydrogenated polyoxyl 40 castor oil Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Solubilizing agent; Surfactant
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 800 uM (tested by experiment) [4]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 0.25 mg.mL-1 (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Hypromellose Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Coating agent
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Protein expression upregulation (tested by experiment) [3]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Protein expression downregulation (tested by experiment) [3]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Magnesium stearate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
lubricant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Protein expression downregulation (tested by experiment) [3]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Poloxamer 188 Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Solubilizing agent; Surfactant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 60 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Poloxamer 407 Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Solubilizing agent; Surfactant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 32.8 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Polyethylene glycol 1000 Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Coating agent; Diluent; Ointment base; Plasticizing agent; Solvent; Suppository base; lubricant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio < 60 % (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Polyethylene glycol 200 Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Coating agent; Diluent; Ointment base; Plasticizing agent; Solvent; Suppository base; lubricant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio < 60 % (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Polyethylene glycol 2000 Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Coating agent; Diluent; Ointment base; Plasticizing agent; Solvent; Suppository base; lubricant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio < 90 % (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Polyethylene glycol 3350 Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Coating agent; Diluent; Ointment base; Plasticizing agent; Solvent; Suppository base; lubricant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Protein expression upregulation (tested by experiment) [3]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Polyethylene glycol 400 Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Coating agent; Diluent; Ointment base; Plasticizing agent; Solvent; Suppository base; lubricant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 10.77 mg.mL-1 (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Polyethylene glycol 4000 Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Coating agent; Diluent; Ointment base; Plasticizing agent; Solvent; Suppository base; lubricant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio < 40 % (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Polyethylene glycol 6000 Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Coating agent; Diluent; Ointment base; Plasticizing agent; Solvent; Suppository base; lubricant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio < 70 % (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Polyoxyl 35 castor oil Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Solubilizing agent; Surfactant
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 306.5 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 600 uM (tested by experiment) [4]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Polyoxyl 40 stearate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Surfactant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 322.2 uM (tested by experiment) [5]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Polysorbate 20 Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Dispersing agent; Emollient; Emulsifying agent; Plasticizing agent; Solubilizing agent; Surfactant; Suspending agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 363.7 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Polysorbate 80 Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Dispersing agent; Emollient; Emulsifying agent; Plasticizing agent; Solubilizing agent; Surfactant; Suspending agent
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 201 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 400 uM (tested by experiment) [4]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
             Experiment (3) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Protein expression downregulation (tested by experiment) [3]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Povidone Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Binding agent; Coating agent; Disintegrant; Film/membrane-forming agent; Solubilizing agent; Suspending agent
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 107 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Protein expression upregulation (tested by experiment) [3]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Propylene glycol Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative; Humectant; Plasticizing agent; Solvent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio < 20 % (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Silicon dioxide Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Anticaking agent; Opacifying agent; Viscosity-controlling agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Protein expression downregulation (tested by experiment) [3]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Sodium alginate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Binding agent; Disintegrant; Suspending agent; Viscosity-controlling agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio < 20 % (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Soybean lecithin Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Other agent
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 6.61 mg.mL-1 (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Tocophersolan Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antioxidant; Binding agent; Emulsifying agent; Ointment base; Solubilizing agent; Surfactant; Suspending agent
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 28.3 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 150 uM (tested by experiment) [4]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Sodium lauryl sulfoacetate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Complexing agent; Surfactant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 0.29 mg.mL-1 (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Sodium sulhydrate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Antimicrobial preservative
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Inhibition ratio < 90 % (tested by experiment) [2]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Polyoxyl 15 hydroxystearate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Solubilizing agent; Surfactant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 88.3 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Pregelatinized starch Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Binding agent; Diluent; Disintegrant
             Experiment (1) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Protein expression downregulation (tested by experiment) [3]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
             Experiment (2) for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity Protein expression downregulation (tested by experiment) [3]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Sodium caprylate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Emulsifying agent; Surfactant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity EC50 = 9.5 uM (tested by experiment) [1]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
          DIG Name: Sucrose laurate Click to Show/Hide
             Detailed Information DIG Info click to show the detail info of this DIG
             Functional Class    Click to Show/Hide the Functional Class of This DIG
Surfactant
             Experiment for Assessing the Biological Activity of This DIG on the Studied DBT
                   Biological Activity IC50 = 200 uM (tested by experiment) [4]
                   Tested Species Homo sapiens (Human)
                   UniProt ID CP3A4_HUMAN
References
1 Mediation of in vitro cytochrome p450 activity by common pharmaceutical excipients. Mol Pharm. 2013 Jul 1;10(7):2739-48.
2 Pharmaceutical excipients inhibit cytochrome P450 activity in cell free systems and after systemic administration. Eur J Pharm Biopharm. 2008 Sep;70(1):279-88.
3 Effects of commonly used excipients on the expression of CYP3A4 in colon and liver cells. Pharm Res. 2010 Aug;27(8):1703-12.
4 Effects of non-ionic surfactants on cytochrome P450-mediated metabolism in vitro. Eur J Pharm Biopharm. 2011 May;78(1):166-72.
5 Effects of polyoxyethylene (40) stearate on the activity of P-glycoprotein and cytochrome P450. Eur J Pharm Sci. 2009 Jul 12;37(5):573-80.

If you find any error in data or bug in web service, please kindly report it to Dr. Zhang and Dr. Mou.